KEGG   Homo sapiens (human): 2324Help
Entry
2324              CDS       T01001                                 

Gene name
FLT4, FLT41, LMPH1A, PCL, VEGFR3
Definition
fms-related tyrosine kinase 4 (EC:2.7.10.1)
Orthology
K05097  
FMS-like tyrosine kinase 4 [EC:2.7.10.1]
Organism
hsa  Homo sapiens (human)
Pathway
Ras signaling pathway
Rap1 signaling pathway
Cytokine-cytokine receptor interaction
PI3K-Akt signaling pathway
Focal adhesion
Disease
H00535  
Lymphedemas
Drug target
Class
Environmental Information Processing; Signal transduction; Ras signaling pathway [PATH:hsa04014]
Environmental Information Processing; Signal transduction; Rap1 signaling pathway [PATH:hsa04015]
Environmental Information Processing; Signal transduction; PI3K-Akt signaling pathway [PATH:hsa04151]
Environmental Information Processing; Signaling molecules and interaction; Cytokine-cytokine receptor interaction [PATH:hsa04060]
Cellular Processes; Cell communication; Focal adhesion [PATH:hsa04510]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
5q35.3
AA seq 1298 aa AA seqDB search
MQRGAALCLRLWLCLGLLDGLVSGYSMTPPTLNITEESHVIDTGDSLSISCRGQHPLEWA
WPGAQEAPATGDKDSEDTGVVRDCEGTDARPYCKVLLLHEVHANDTGSYVCYYKYIKARI
EGTTAASSYVFVRDFEQPFINKPDTLLVNRKDAMWVPCLVSIPGLNVTLRSQSSVLWPDG
QEVVWDDRRGMLVSTPLLHDALYLQCETTWGDQDFLSNPFLVHITGNELYDIQLLPRKSL
ELLVGEKLVLNCTVWAEFNSGVTFDWDYPGKQAERGKWVPERRSQQTHTELSSILTIHNV
SQHDLGSYVCKANNGIQRFRESTEVIVHENPFISVEWLKGPILEATAGDELVKLPVKLAA
YPPPEFQWYKDGKALSGRHSPHALVLKEVTEASTGTYTLALWNSAAGLRRNISLELVVNV
PPQIHEKEASSPSIYSRHSRQALTCTAYGVPLPLSIQWHWRPWTPCKMFAQRSLRRRQQQ
DLMPQCRDWRAVTTQDAVNPIESLDTWTEFVEGKNKTVSKLVIQNANVSAMYKCVVSNKV
GQDERLIYFYVTTIPDGFTIESKPSEELLEGQPVLLSCQADSYKYEHLRWYRLNLSTLHD
AHGNPLLLDCKNVHLFATPLAASLEEVAPGARHATLSLSIPRVAPEHEGHYVCEVQDRRS
HDKHCHKKYLSVQALEAPRLTQNLTDLLVNVSDSLEMQCLVAGAHAPSIVWYKDERLLEE
KSGVDLADSNQKLSIQRVREEDAGRYLCSVCNAKGCVNSSASVAVEGSEDKGSMEIVILV
GTGVIAVFFWVLLLLIFCNMRRPAHADIKTGYLSIIMDPGEVPLEEQCEYLSYDASQWEF
PRERLHLGRVLGYGAFGKVVEASAFGIHKGSSCDTVAVKMLKEGATASEHRALMSELKIL
IHIGNHLNVVNLLGACTKPQGPLMVIVEFCKYGNLSNFLRAKRDAFSPCAEKSPEQRGRF
RAMVELARLDRRRPGSSDRVLFARFSKTEGGARRASPDQEAEDLWLSPLTMEDLVCYSFQ
VARGMEFLASRKCIHRDLAARNILLSESDVVKICDFGLARDIYKDPDYVRKGSARLPLKW
MAPESIFDKVYTTQSDVWSFGVLLWEIFSLGASPYPGVQINEEFCQRLRDGTRMRAPELA
TPAIRRIMLNCWSGDPKARPAFSELVEILGDLLQGRGLQEEEEVCMAPRSSQSSEEGSFS
QVSTMALHIAQADAEDSPPSLQRHSLAARYYNWVSFPGCLARGAETRGSSRMKTFEEFPM
TPTTYKGSVDNQTDSGMVLASEEFEQIESRHRQESGFR
NT seq 3897 nt NT seq  +upstreamnt  +downstreamnt
atgcagcggggcgccgcgctgtgcctgcgactgtggctctgcctgggactcctggacggc
ctggtgagtggctactccatgacccccccgaccttgaacatcacggaggagtcacacgtc
atcgacaccggtgacagcctgtccatctcctgcaggggacagcaccccctcgagtgggct
tggccaggagctcaggaggcgccagccaccggagacaaggacagcgaggacacgggggtg
gtgcgagactgcgagggcacagacgccaggccctactgcaaggtgttgctgctgcacgag
gtacatgccaacgacacaggcagctacgtctgctactacaagtacatcaaggcacgcatc
gagggcaccacggccgccagctcctacgtgttcgtgagagactttgagcagccattcatc
aacaagcctgacacgctcttggtcaacaggaaggacgccatgtgggtgccctgtctggtg
tccatccccggcctcaatgtcacgctgcgctcgcaaagctcggtgctgtggccagacggg
caggaggtggtgtgggatgaccggcggggcatgctcgtgtccacgccactgctgcacgat
gccctgtacctgcagtgcgagaccacctggggagaccaggacttcctttccaaccccttc
ctggtgcacatcacaggcaacgagctctatgacatccagctgttgcccaggaagtcgctg
gagctgctggtaggggagaagctggtcctgaactgcaccgtgtgggctgagtttaactca
ggtgtcacctttgactgggactacccagggaagcaggcagagcggggtaagtgggtgccc
gagcgacgctcccagcagacccacacagaactctccagcatcctgaccatccacaacgtc
agccagcacgacctgggctcgtatgtgtgcaaggccaacaacggcatccagcgatttcgg
gagagcaccgaggtcattgtgcatgaaaatcccttcatcagcgtcgagtggctcaaagga
cccatcctggaggccacggcaggagacgagctggtgaagctgcccgtgaagctggcagcg
taccccccgcccgagttccagtggtacaaggatggaaaggcactgtccgggcgccacagt
ccacatgccctggtgctcaaggaggtgacagaggccagcacaggcacctacaccctcgcc
ctgtggaactccgctgctggcctgaggcgcaacatcagcctggagctggtggtgaatgtg
cccccccagatacatgagaaggaggcctcctcccccagcatctactcgcgtcacagccgc
caggccctcacctgcacggcctacggggtgcccctgcctctcagcatccagtggcactgg
cggccctggacaccctgcaagatgtttgcccagcgtagtctccggcggcggcagcagcaa
gacctcatgccacagtgccgtgactggagggcggtgaccacgcaggatgccgtgaacccc
atcgagagcctggacacctggaccgagtttgtggagggaaagaataagactgtgagcaag
ctggtgatccagaatgccaacgtgtctgccatgtacaagtgtgtggtctccaacaaggtg
ggccaggatgagcggctcatctacttctatgtgaccaccatccccgacggcttcaccatc
gaatccaagccatccgaggagctactagagggccagccggtgctcctgagctgccaagcc
gacagctacaagtacgagcatctgcgctggtaccgcctcaacctgtccacgctgcacgat
gcgcacgggaacccgcttctgctcgactgcaagaacgtgcatctgttcgccacccctctg
gccgccagcctggaggaggtggcacctggggcgcgccacgccacgctcagcctgagtatc
ccccgcgtcgcgcccgagcacgagggccactatgtgtgcgaagtgcaagaccggcgcagc
catgacaagcactgccacaagaagtacctgtcggtgcaggccctggaagcccctcggctc
acgcagaacttgaccgacctcctggtgaacgtgagcgactcgctggagatgcagtgcttg
gtggccggagcgcacgcgcccagcatcgtgtggtacaaagacgagaggctgctggaggaa
aagtctggagtcgacttggcggactccaaccagaagctgagcatccagcgcgtgcgcgag
gaggatgcgggacgctatctgtgcagcgtgtgcaacgccaagggctgcgtcaactcctcc
gccagcgtggccgtggaaggctccgaggataagggcagcatggagatcgtgatccttgtc
ggtaccggcgtcatcgctgtcttcttctgggtcctcctcctcctcatcttctgtaacatg
aggaggccggcccacgcagacatcaagacgggctacctgtccatcatcatggaccccggg
gaggtgcctctggaggagcaatgcgaatacctgtcctacgatgccagccagtgggaattc
ccccgagagcggctgcacctggggagagtgctcggctacggcgccttcgggaaggtggtg
gaagcctccgctttcggcatccacaagggcagcagctgtgacaccgtggccgtgaaaatg
ctgaaagagggcgccacggccagcgagcaccgcgcgctgatgtcggagctcaagatcctc
attcacatcggcaaccacctcaacgtggtcaacctcctcggggcgtgcaccaagccgcag
ggccccctcatggtgatcgtggagttctgcaagtacggcaacctctccaacttcctgcgc
gccaagcgggacgccttcagcccctgcgcggagaagtctcccgagcagcgcggacgcttc
cgcgccatggtggagctcgccaggctggatcggaggcggccggggagcagcgacagggtc
ctcttcgcgcggttctcgaagaccgagggcggagcgaggcgggcttctccagaccaagaa
gctgaggacctgtggctgagcccgctgaccatggaagatcttgtctgctacagcttccag
gtggccagagggatggagttcctggcttcccgaaagtgcatccacagagacctggctgct
cggaacattctgctgtcggaaagcgacgtggtgaagatctgtgactttggccttgcccgg
gacatctacaaagaccccgactacgtccgcaagggcagtgcccggctgcccctgaagtgg
atggcccctgaaagcatcttcgacaaggtgtacaccacgcagagtgacgtgtggtccttt
ggggtgcttctctgggagatcttctctctgggggcctccccgtaccctggggtgcagatc
aatgaggagttctgccagcggctgagagacggcacaaggatgagggccccggagctggcc
actcccgccatacgccgcatcatgctgaactgctggtccggagaccccaaggcgagacct
gcattctcggagctggtggagatcctgggggacctgctccagggcaggggcctgcaagag
gaagaggaggtctgcatggccccgcgcagctctcagagctcagaagagggcagcttctcg
caggtgtccaccatggccctacacatcgcccaggctgacgctgaggacagcccgccaagc
ctgcagcgccacagcctggccgccaggtattacaactgggtgtcctttcccgggtgcctg
gccagaggggctgagacccgtggttcctccaggatgaagacatttgaggaattccccatg
accccaacgacctacaaaggctctgtggacaaccagacagacagtgggatggtgctggcc
tcggaggagtttgagcagatagagagcaggcatagacaagaaagcggcttcaggtag

DBGET integrated database retrieval system