KEGG   Homo sapiens (human): 23246Help
Entry
23246             CDS       T01001                                 

Gene name
BOP1
Definition
(RefSeq) block of proliferation 1
  KO
K14824  
ribosome biogenesis protein ERB1
Organism
hsa  Homo sapiens (human)
Brite
Ribosome biogenesis [BR:hsa03009]
 Eukaryotic Type
  Pre-60S particles
   Other pre-60S particles
    23246 (BOP1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
8q24.3
AA seq 746 aa AA seqDB search
MAGSRGAGRTAAPSVRPEKRRSEPELEPEPEPEPPLLCTSPLSHSTGSDSGVSDSEESVF
SGLEDSGSDSSEDDDEGDEEGEDGALDDEGHSGIKKTTEEQVQASTPCPRTEMASARIGD
EYAEDSSDEEDIRNTVGNVPLEWYDDFPHVGYDLDGRRIYKPLRTRDELDQFLDKMDDPD
YWRTVQDPMTGRDLRLTDEQVALVRRLQSGQFGDVGFNPYEPAVDFFSGDVMIHPVTNRP
ADKRSFIPSLVEKEKVSRMVHAIKMGWIQPRRPRDPTPSFYDLWAQEDPNAVLGRHKMHV
PAPKLALPGHAESYNPPPEYLLSEEERLAWEQQEPGERKLSFLPRKFPSLRAVPAYGRFI
QERFERCLDLYLCPRQRKMRVNVDPEDLIPKLPRPRDLQPFPTCQALVYRGHSDLVRCLS
VSPGGQWLVSGSDDGSLRLWEVATARCVRTVPVGGVVKSVAWNPSPAVCLVAAAVEDSVL
LLNPALGDRLVAGSTDQLLSAFVPPEEPPLQPARWLEASEEERQVGLRLRICHGKPVTQV
TWHGRGDYLAVVLATQGHTQVLIHQLSRRRSQSPFRRSHGQVQRVAFHPARPFLLVASQR
SVRLYHLLRQELTKKLMPNCKWVSSLAVHPAGDNVICGSYDSKLVWFDLDLSTKPYRMLR
HHKKALRAVAFHPRYPLFASGSDDGSVIVCHGMVYNDLLQNPLLVPVKVLKGHVLTRDLG
VLDVIFHPTQPWVFSSGADGTVRLFT
NT seq 2241 nt NT seq  +upstreamnt  +downstreamnt
atggcgggttcgcggggtgcggggcgcacggcggcgccgagcgtgcggccggagaagcgg
cggtctgagcccgaactggagcctgagcccgagccggagccccccctcctctgcacctct
cctctcagccacagcaccggcagcgattctggcgtctccgacagcgaggaaagtgtgttc
tcaggcctggaagattccggcagtgacagcagtgaggatgatgacgaaggcgacgaggag
ggagaggacggagcccttgatgacgagggccacagtgggattaaaaagaccactgaggag
caggtgcaggccagcactccttgcccgaggacagagatggcgagcgcccggattggggat
gagtatgcggaggacagctctgatgaggaggacatccggaacacggtgggcaacgtgccc
ttggagtggtacgatgacttcccccacgtgggctacgacctggatggcaggcgcatctac
aagcccctgcggacccgggatgagctggaccagttcctggacaagatggacgatcctgac
tactggcgcaccgtgcaggacccgatgacagggcgggacctgagactgacggatgagcag
gtggccctggtgcggcggctgcagagtggccagtttggggatgtgggcttcaacccctat
gagccggctgtcgacttcttcagcggggacgtcatgatccacccggtgaccaaccgcccg
gccgacaagcgcagcttcatcccctccctggtggagaaggagaaggtctctcgcatggtg
cacgccatcaagatgggctggatccagcctcgccggccccgagaccccacccccagcttc
tatgacctgtgggcccaggaggaccccaacgccgtgctcgggcgccacaagatgcacgta
cctgctcccaagctggccctgccaggccacgccgagtcgtacaacccaccccctgaatac
ctgctcagcgaggaggagcgcttggcgtgggaacagcaggagccaggcgagaggaagctg
agctttttgccacgcaagttcccgagcctgcgggccgtgcctgcctacggacgcttcatc
caggaacgcttcgagcgctgccttgacctgtacctgtgcccacggcagcgcaagatgagg
gtgaatgtagaccctgaggacctcatccccaagctgcctcggccgagggacctgcagccc
ttccccacgtgccaggccctggtctacaggggccacagtgaccttgtccggtgcctcagt
gtctctcctgggggccagtggctggtttcaggctctgacgacggctccctgcggctctgg
gaggtggccactgcccgctgtgtgaggactgttcccgtggggggcgtggtgaagagtgtg
gcctggaaccccagccccgctgtctgcctggtggctgcagccgtggaggactcggtgctg
ctgctgaacccagctctgggggaccggctggtggcgggcagcacagatcagctgttgagc
gccttcgtcccgcctgaggagccccccttgcagccggcccgctggctggaggcctcagag
gaggagcgccaagtgggcctgcggctgcgcatctgccacgggaagccagtgacgcaggtg
acctggcacgggcgtggggactacctggccgtggtgctggccacccaaggccacacccag
gtgctgattcaccagctgagccgtcgccgcagccagagtccgttccgccgcagccacgga
caggtgcagcgagtggccttccaccctgcccggcccttcctgttggtggcgtcccagcgc
agcgtccgcctctaccacctgctgcgccaggagctcaccaagaagctgatgcccaactgc
aagtgggtgtccagcctggcggtgcaccctgcaggtgacaacgtcatctgtgggagctac
gatagcaagctggtgtggtttgacctggatctttccaccaagccatacaggatgctgaga
caccacaagaaggctctgcgggctgtggccttccacccgcggtacccactctttgcgtca
ggctcggacgacggcagtgtcatcgtctgccatggcatggtgtacaatgaccttctgcag
aaccccttgctggtgcccgtcaaggtgctgaagggacacgtgctgacccgagatctggga
gtgctggacgtcatcttccaccccacccagccgtgggtcttctcctcgggggcagacggg
actgtccgcctcttcacctag

DBGET integrated database retrieval system