KEGG   Homo sapiens (human): 23275Help
Entry
23275             CDS       T01001                                 

Gene name
POFUT2, C21orf80, FUT13
Definition
(RefSeq) protein O-fucosyltransferase 2
  KO
K03691  
peptide-O-fucosyltransferase [EC:2.4.1.221]
Organism
hsa  Homo sapiens (human)
Pathway
Other types of O-glycan biosynthesis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00514 Other types of O-glycan biosynthesis
    23275 (POFUT2)
Enzymes [BR:hsa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.221  peptide-O-fucosyltransferase
     23275 (POFUT2)
Glycosyltransferases [BR:hsa01003]
 O-Glycan biosynthesis
  O-linked Fuc type
   23275 (POFUT2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
Pharos: 
Q9Y2G5(Tbio)
UniProt: 
Structure
PDB: 

Jmol
Position
21q22.3
AA seq 429 aa AA seqDB search
MATLSFVFLLLGAVSWPPASASGQEFWPGQSAADILSGAASRRRYLLYDVNPPEGFNLRR
DVYIRIASLLKTLLKTEEWVLVLPPWGRLYHWQSPDIHQVRIPWSEFFDLPSLNKNIPVI
EYEQFIAESGGPFIDQVYVLQSYAEGWKEGTWEEKVDERPCIDQLLYSQDKHEYYRGWFW
GYEETRGLNVSCLSVQGSASIVAPLLLRNTSARSVMLDRAENLLHDHYGGKEYWDTRRSM
VFARHLREVGDEFRSRHLNSTDDADRIPFQEDWMKMKVKLGSALGGPYLGVHLRRKDFIW
GHRQDVPSLEGAVRKIRSLMKTHRLDKVFVATDAVRKEYEELKKLLPEMVRFEPTWEELE
LYKDGGVAIIDQWICAHARFFIGTSVSTFSFRIHEEREILGLDPKTTYNRFCGDQEKACE
QPTHWKITY
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atggcgacactcagcttcgtcttcctgctgctgggggcagtgtcctggcctccggcttct
gcctccggccaggagttctggcccggacaatcggcggccgatattctgtcgggggcggct
tcccgcagacggtatcttctgtatgacgtcaaccccccggaaggcttcaacctgcgcagg
gatgtctatatccgaatcgcctctctcctgaagactctgctgaagacggaggagtgggtg
cttgtcctgcctccatggggccgcctctatcactggcagagtcctgacatccaccaggtc
cggattccctggtctgagttttttgatcttccaagtctcaataaaaacatccccgtcatc
gagtatgagcagttcatcgcagaatctggtgggccctttattgaccaggtttacgtcctg
caaagttacgcagaggggtggaaagaagggacctgggaagagaaggtggacgagcggccg
tgtattgatcagctcctgtactcccaggacaagcacgagtactacagaggatggttttgg
ggttatgaggagaccaggggtctaaacgtctcctgtctgtccgtccagggctcagcctcc
atcgtggcgcccctgctgctgagaaacacatcagcccggtccgtgatgttagacagagcc
gagaacctacttcacgaccactatggagggaaagaatactgggatacccgtcgcagcatg
gtgtttgccaggcacctgcgggaggtgggagacgagttcaggagcagacatctcaactcc
acggacgacgcagacaggatccccttccaggaggactggatgaagatgaaggtcaagctg
ggctccgcgctagggggcccctacctgggagtccacctgagaagaaaagatttcatctgg
ggtcacagacaggatgtacccagtctggaaggggccgtgaggaagatccgcagcctcatg
aagacccaccggctggacaaggtgtttgtggccacagatgccgtcagaaaggaatatgaa
gagctaaaaaagctgttacccgagatggtgaggtttgaacccacgtgggaggagctggag
ctctacaaggacggaggcgttgcgattattgaccagtggatctgcgcacacgccaggttt
tttattggcacctcagtctcaacattttcttttcggattcatgaggaaagagaaatcctg
gggttggaccccaagacgacgtacaacaggttctgcggagaccaagagaaggcgtgtgag
caacccacccactggaagatcacctactga

DBGET integrated database retrieval system