KEGG   Homo sapiens (human): 23279Help
Entry
23279             CDS       T01001                                 

Gene name
NUP160
Definition
nucleoporin 160kDa
Orthology
K14303  
nuclear pore complex protein Nup160
Organism
hsa  Homo sapiens (human)
Pathway
RNA transport
Module
Nuclear pore complex
Class
Genetic Information Processing; Translation; RNA transport [PATH:hsa03013]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
11p11.2
AA seq 1436 aa AA seqDB search
MLHLSAAPPAPPPEVTATARPCLCSVGRRGDGGKMAAAGALERSFVELSGAERERPRHFR
EFTVCSIGTANAVAGAVKYSESAGGFYYVESGKLFSVTRNRFIHWKTSGDTLELMEESLD
INLLNNAIRLKFQNCSVLPGGVYVSETQNRVIILMLTNQTVHRLLLPHPSRMYRSELVVD
SQMQSIFTDIGKVDFTDPCNYQLIPAVPGISPNSTASTAWLSSDGEALFALPCASGGIFV
LKLPPYDIPGMVSVVELKQSSVMQRLLTGWMPTAIRGDQSPSDRPLSLAVHCVEHDAFIF
ALCQDHKLRMWSYKEQMCLMVADMLEYVPVKKDLRLTAGTGHKLRLAYSPTMGLYLGIYM
HAPKRGQFCIFQLVSTESNRYSLDHISSLFTSQETLIDFALTSTDIWALWHDAENQTVVK
YINFEHNVAGQWNPVFMQPLPEEEIVIRDDQDPREMYLQSLFTPGQFTNEALCKALQIFC
RGTERNLDLSWSELKKEVTLAVENELQGSVTEYEFSQEEFRNLQQEFWCKFYACCLQYQE
ALSHPLALHLNPHTNMVCLLKKGYLSFLIPSSLVDHLYLLPYENLLTEDETTISDDVDIA
RDVICLIKCLRLIEESVTVDMSVIMEMSCYNLQSPEKAAEQILEDMITIDVENVMEDICS
KLQEIRNPIHAIGLLIREMDYETEVEMEKGFNPAQPLNIRMNLTQLYGSNTAGYIVCRGV
HKIASTRFLICRDLLILQQLLMRLGDAVIWGTGQLFQAQQDLLHRTAPLLLSYYLIKWGS
ECLATDVPLDTLESNLQHLSVLELTDSGALMANRFVSSPQTIVELFFQEVARKHIISHLF
SQPKAPLSQTGLNWPEMITAITSYLLQLLWPSNPGCLFLECLMGNCQYVQLQDYIQLLHP
WCQVNVGSCRFMLGRCYLVTGEGQKALECFCQAASEVGKEEFLDRLIRSEDGEIVSTPRL
QYYDKVLRLLDVIGLPELVIQLATSAITEAGDDWKSQATLRTCIFKHHLDLGHNSQAYEA
LTQIPDSSRQLDCLRQLVVVLCERSQLQDLVEFPYVNLHNEVVGIIESRARAVDLMTHNY
YELLYAFHIYRHNYRKAGTVMFEYGMRLGREVRTLRGLEKQGNCYLAALNCLRLIRPEYA
WIVQPVSGAVYDRPGASPKRNHDGECTAAPTNRQIEILELEDLEKECSLARIRLTLAQHD
PSAVAVAGSSSAEEMVTLLVQAGLFDTAISLCQTFKLPLTPVFEGLAFKCIKLQFGGEAA
QAEAWAWLAANQLSSVITTKESSATDEAWRLLSTYLERYKVQNNLYHHCVINKLLSHGVP
LPNWLINSYKKVDAAELLRLYLNYDLLEEAVDLVSEYVDAVLGKGHQYFGIEFPLSATAP
MVWLPYSSIDQLLQALGENSANSHNIALSQKILDKLEDYQQKVDKATRDLLYRRTL
NT seq 4311 nt NT seq  +upstreamnt  +downstreamnt
atgcttcacctgtccgcagctccgcccgccccacccccggaagtgacggcgaccgcgcgg
ccctgcctttgttccgttgggcgtcgcggcgacggcgggaagatggcggcggcgggagcc
ctggaacggagcttcgtggagctaagcggagctgagcgcgaaaggccgaggcactttcgg
gaattcacagtctgcagcattgggactgcaaatgccgtggctggcgccgtaaaatacagt
gaaagcgcgggaggcttttactacgtggagagtggcaagttgttctccgtaaccagaaac
aggttcattcattggaagacctctggagatacattggagctgatggaggagtcactggac
ataaatctgttgaataatgccattcgcctaaaattccaaaattgcagtgttttacctgga
ggggtttatgtctctgagactcagaatcgtgtgataatcttgatgttaaccaatcaaaca
gtgcacaggttacttttaccacacccctcccggatgtataggagtgagttggtagttgac
agtcagatgcagtcaatattcactgacattggaaaagttgatttcacagatccttgcaac
tatcagttaattccagcagtacctggaatatctcctaattccaccgcctctacagcctgg
ctcagcagtgatggggaggccctgtttgccttaccatgtgcttctgggggaatctttgtt
cttaagctacctccttatgacatacctggtatggtgtcagtcgtggaactgaaacagagt
tcagtaatgcaacgattgcttacaggctggatgccaacagctatcaggggtgaccagtcg
ccttcagatcgtcccctcagtcttgctgttcattgtgtggagcatgatgccttcatcttt
gctttgtgtcaggatcataaactacgaatgtggtcttacaaggagcaaatgtgcctaatg
gtagctgacatgctggagtatgtccctgtgaagaaagaccttcggcttactgctggaact
ggacacaaattacggcttgcttattcccccaccatgggactctacctggggatatacatg
catgcaccaaaacgaggacagttctgcattttccagttggtgagcactgagagtaatcgc
tatagtctcgatcatatttcttcactgttcacttctcaggagacactgattgactttgcc
ttaacttccacggatatctgggccctgtggcatgatgctgagaaccaaacagtagtgaaa
tacatcaactttgaacataatgttgcaggtcagtggaatccagtttttatgcagcctctg
ccagaggaagagattgtcatcagagatgatcaagaccccagagagatgtatctgcaaagt
ctttttacaccaggacaattcacaaatgaagctttatgtaaggctttacagattttctgc
cgaggaactgagaggaatttggatctttcctggagtgaactgaagaaagaagttacttta
gctgttgaaaatgagcttcaaggaagtgtaacagagtatgaattctcccaggaggagttt
cgaaatttacaacaagaattctggtgcaagttctatgcctgttgtcttcagtatcaagaa
gccctctctcaccctcttgccctacatttgaatccacacacaaacatggtgtgcctgctg
aaaaaagggtacctgtctttccttattccctcatccttagtggatcatttgtatctcctg
ccttatgagaaccttttgacagaagatgagacaaccatatctgatgatgtggatatcgct
cgggatgtcatatgtcttataaaatgcctccggctgattgaagagtcagtaactgtggat
atgtcagttataatggaaatgagttgttataacctacagtctccggaaaaggctgcagag
cagattctggaagatatgatcactattgatgtagaaaatgtgatggaggatatttgtagt
aaactgcaagagattaggaacccaatccatgcaattggactacttatacgggaaatggat
tatgaaacagaagtggaaatggaaaagggattcaatccagctcagcctttgaatattcga
atgaatcttacccagctctatggtagtaacacagcagggtatattgtgtgcagaggggtg
cataaaatcgccagtactcgtttcctgatctgcagagatcttttgatcttacagcagctg
ttaatgaggcttggagatgctgtgatttggggaactggtcagctctttcaagctcagcaa
gacctactacatcgaacagctcccctactcttatcttattacctcattaaatggggaagt
gagtgcttggcaactgatgttccacttgacacactggagtctaatctccaacacttatca
gtactggaattaacagactctggtgctttaatggcaaataggtttgtatctagtcctcag
actattgtggagttattcttccaagaagttgcaagaaaacacattatatctcacctcttc
tctcagccaaaggcacctctgagccaaactggattgaattggcctgaaatgattactgca
attaccagttatttattgcagcttttatggcctagcaatcctggttgtctctttctagaa
tgtttgatgggaaattgccaatatgtacaattgcaggattatattcaactgctacatccc
tggtgtcaagtcaatgttggttcctgtcgatttatgctgggaaggtgttacctagttaca
ggagaaggacagaaggctctggaatgtttttgtcaggcagcatctgaagtaggcaaagag
gaattcttggatcgcttgattcgctcagaggatggggagatcgtgtctacccccaggctg
cagtattatgacaaggttttacgactactagatgtcattggtttgcctgaactggttatt
cagttggctacatcagccataactgaagcaggtgatgactggaaaagtcaggctactcta
aggacatgtattttcaaacatcatttggatttgggtcacaatagccaagcatatgaagcc
ttaacccaaattcctgattccagcaggcaattagattgtttacggcagttggtggtagtt
ctttgtgaacgctcacagctacaggatcttgtagagtttccctatgtgaatctgcataat
gaggttgtgggaataattgagtcacgtgctagagctgtggaccttatgactcacaattac
tatgaacttctgtatgcctttcacatctatcgccacaattaccgcaaggctggcacagtg
atgtttgagtatggaatgcggcttggcagagaagttcgaactctccggggacttgagaaa
caaggcaactgttatctggctgctctcaattgtttacgacttattcgtccagaatatgcg
tggattgtgcagccagtgtctggtgcagtgtatgatcgccctggagcatcccctaagagg
aatcatgatggagaatgcacagctgcccccacaaatcgacaaattgaaatcctggaactg
gaagatctggagaaagagtgttccttggctcgcatccgcctcactttggctcagcatgat
ccatcagcggttgcagttgctggaagttcatcagcagaggaaatggtcactctcttggtt
caggcgggcctctttgacactgccatatcactctgtcagacttttaagcttcccttaacg
ccagtctttgaagggcttgccttcaaatgcatcaaattgcaatttggaggagaggcagca
caagcagaagcctgggcctggctagcagccaatcagctctcatctgtcatcactactaag
gagtctagtgctacagatgaagcatggcgactattatccacttacctggagaggtacaaa
gtccagaataacttgtatcaccactgtgtaatcaacaagctcttgtctcatggagtgcct
ctgcctaattggcttataaacagttacaagaaggttgatgctgctgaattgcttcgttta
tacttaaactatgaccttttagaagaagctgtggatttggtgtcagaatatgtggatgct
gtattgggaaaaggacatcaatacttcggaattgagtttccactgtccgcaacagcccca
atggtgtggcttccatactcctctattgatcagcttctccaagctctgggagagaacagt
gccaacagtcacaacatcgcactgtcccagaaaatacttgacaaattggaggactaccag
caaaaagttgataaggcaacacgggatttattatatcgtcggaccttgtga

DBGET integrated database retrieval system