KEGG   Homo sapiens (human): 23279Help
Entry
23279             CDS       T01001                                 

Gene name
NUP160
Definition
(RefSeq) nucleoporin 160
  KO
K14303  nuclear pore complex protein Nup160
Organism
hsa  Homo sapiens (human)
Pathway
hsa03013  RNA transport
Module
hsa_M00427  Nuclear pore complex
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    23279 (NUP160)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    Nuclear pore complex
     23279 (NUP160)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Spindle formation proteins
    23279 (NUP160)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Nup160
Motif
Other DBs
NCBI-GeneID: 23279
NCBI-ProteinID: NP_056046
OMIM: 607614
HGNC: 18017
Ensembl: ENSG00000030066
Vega: OTTHUMG00000166534
Pharos: Q12769(Tbio)
UniProt: Q12769
Structure
PDB: 

Jmol
Position
11p11.2
AA seq 1436 aa AA seqDB search
MLHLSAAPPAPPPEVTATARPCLCSVGRRGDGGKMAAAGALERSFVELSGAERERPRHFR
EFTVCSIGTANAVAGAVKYSESAGGFYYVESGKLFSVTRNRFIHWKTSGDTLELMEESLD
INLLNNAIRLKFQNCSVLPGGVYVSETQNRVIILMLTNQTVHRLLLPHPSRMYRSELVVD
SQMQSIFTDIGKVDFTDPCNYQLIPAVPGISPNSTASTAWLSSDGEALFALPCASGGIFV
LKLPPYDIPGMVSVVELKQSSVMQRLLTGWMPTAIRGDQSPSDRPLSLAVHCVEHDAFIF
ALCQDHKLRMWSYKEQMCLMVADMLEYVPVKKDLRLTAGTGHKLRLAYSPTMGLYLGIYM
HAPKRGQFCIFQLVSTESNRYSLDHISSLFTSQETLIDFALTSTDIWALWHDAENQTVVK
YINFEHNVAGQWNPVFMQPLPEEEIVIRDDQDPREMYLQSLFTPGQFTNEALCKALQIFC
RGTERNLDLSWSELKKEVTLAVENELQGSVTEYEFSQEEFRNLQQEFWCKFYACCLQYQE
ALSHPLALHLNPHTNMVCLLKKGYLSFLIPSSLVDHLYLLPYENLLTEDETTISDDVDIA
RDVICLIKCLRLIEESVTVDMSVIMEMSCYNLQSPEKAAEQILEDMITIDVENVMEDICS
KLQEIRNPIHAIGLLIREMDYETEVEMEKGFNPAQPLNIRMNLTQLYGSNTAGYIVCRGV
HKIASTRFLICRDLLILQQLLMRLGDAVIWGTGQLFQAQQDLLHRTAPLLLSYYLIKWGS
ECLATDVPLDTLESNLQHLSVLELTDSGALMANRFVSSPQTIVELFFQEVARKHIISHLF
SQPKAPLSQTGLNWPEMITAITSYLLQLLWPSNPGCLFLECLMGNCQYVQLQDYIQLLHP
WCQVNVGSCRFMLGRCYLVTGEGQKALECFCQAASEVGKEEFLDRLIRSEDGEIVSTPRL
QYYDKVLRLLDVIGLPELVIQLATSAITEAGDDWKSQATLRTCIFKHHLDLGHNSQAYEA
LTQIPDSSRQLDCLRQLVVVLCERSQLQDLVEFPYVNLHNEVVGIIESRARAVDLMTHNY
YELLYAFHIYRHNYRKAGTVMFEYGMRLGREVRTLRGLEKQGNCYLAALNCLRLIRPEYA
WIVQPVSGAVYDRPGASPKRNHDGECTAAPTNRQIEILELEDLEKECSLARIRLTLAQHD
PSAVAVAGSSSAEEMVTLLVQAGLFDTAISLCQTFKLPLTPVFEGLAFKCIKLQFGGEAA
QAEAWAWLAANQLSSVITTKESSATDEAWRLLSTYLERYKVQNNLYHHCVINKLLSHGVP
LPNWLINSYKKVDAAELLRLYLNYDLLEEAVDLVSEYVDAVLGKGHQYFGIEFPLSATAP
MVWLPYSSIDQLLQALGENSANSHNIALSQKILDKLEDYQQKVDKATRDLLYRRTL
NT seq 4311 nt NT seq  +upstreamnt  +downstreamnt
atgcttcacctgtccgcagctccgcccgccccacccccggaagtgacggcgaccgcgcgg
ccctgcctttgttccgttgggcgtcgcggcgacggcgggaagatggcggcggcgggagcc
ctggaacggagcttcgtggagctaagcggagctgagcgcgaaaggccgaggcactttcgg
gaattcacagtctgcagcattgggactgcaaatgccgtggctggcgccgtaaaatacagt
gaaagcgcgggaggcttttactacgtggagagtggcaagttgttctccgtaaccagaaac
aggttcattcattggaagacctctggagatacattggagctgatggaggagtcactggac
ataaatctgttgaataatgccattcgcctaaaattccaaaattgcagtgttttacctgga
ggggtttatgtctctgagactcagaatcgtgtgataatcttgatgttaaccaatcaaaca
gtgcacaggttacttttaccacacccctcccggatgtataggagtgagttggtagttgac
agtcagatgcagtcaatattcactgacattggaaaagttgatttcacagatccttgcaac
tatcagttaattccagcagtacctggaatatctcctaattccaccgcctctacagcctgg
ctcagcagtgatggggaggccctgtttgccttaccatgtgcttctgggggaatctttgtt
cttaagctacctccttatgacatacctggtatggtgtcagtcgtggaactgaaacagagt
tcagtaatgcaacgattgcttacaggctggatgccaacagctatcaggggtgaccagtcg
ccttcagatcgtcccctcagtcttgctgttcattgtgtggagcatgatgccttcatcttt
gctttgtgtcaggatcataaactacgaatgtggtcttacaaggagcaaatgtgcctaatg
gtagctgacatgctggagtatgtccctgtgaagaaagaccttcggcttactgctggaact
ggacacaaattacggcttgcttattcccccaccatgggactctacctggggatatacatg
catgcaccaaaacgaggacagttctgcattttccagttggtgagcactgagagtaatcgc
tatagtctcgatcatatttcttcactgttcacttctcaggagacactgattgactttgcc
ttaacttccacggatatctgggccctgtggcatgatgctgagaaccaaacagtagtgaaa
tacatcaactttgaacataatgttgcaggtcagtggaatccagtttttatgcagcctctg
ccagaggaagagattgtcatcagagatgatcaagaccccagagagatgtatctgcaaagt
ctttttacaccaggacaattcacaaatgaagctttatgtaaggctttacagattttctgc
cgaggaactgagaggaatttggatctttcctggagtgaactgaagaaagaagttacttta
gctgttgaaaatgagcttcaaggaagtgtaacagagtatgaattctcccaggaggagttt
cgaaatttacaacaagaattctggtgcaagttctatgcctgttgtcttcagtatcaagaa
gccctctctcaccctcttgccctacatttgaatccacacacaaacatggtgtgcctgctg
aaaaaagggtacctgtctttccttattccctcatccttagtggatcatttgtatctcctg
ccttatgagaaccttttgacagaagatgagacaaccatatctgatgatgtggatatcgct
cgggatgtcatatgtcttataaaatgcctccggctgattgaagagtcagtaactgtggat
atgtcagttataatggaaatgagttgttataacctacagtctccggaaaaggctgcagag
cagattctggaagatatgatcactattgatgtagaaaatgtgatggaggatatttgtagt
aaactgcaagagattaggaacccaatccatgcaattggactacttatacgggaaatggat
tatgaaacagaagtggaaatggaaaagggattcaatccagctcagcctttgaatattcga
atgaatcttacccagctctatggtagtaacacagcagggtatattgtgtgcagaggggtg
cataaaatcgccagtactcgtttcctgatctgcagagatcttttgatcttacagcagctg
ttaatgaggcttggagatgctgtgatttggggaactggtcagctctttcaagctcagcaa
gacctactacatcgaacagctcccctactcttatcttattacctcattaaatggggaagt
gagtgcttggcaactgatgttccacttgacacactggagtctaatctccaacacttatca
gtactggaattaacagactctggtgctttaatggcaaataggtttgtatctagtcctcag
actattgtggagttattcttccaagaagttgcaagaaaacacattatatctcacctcttc
tctcagccaaaggcacctctgagccaaactggattgaattggcctgaaatgattactgca
attaccagttatttattgcagcttttatggcctagcaatcctggttgtctctttctagaa
tgtttgatgggaaattgccaatatgtacaattgcaggattatattcaactgctacatccc
tggtgtcaagtcaatgttggttcctgtcgatttatgctgggaaggtgttacctagttaca
ggagaaggacagaaggctctggaatgtttttgtcaggcagcatctgaagtaggcaaagag
gaattcttggatcgcttgattcgctcagaggatggggagatcgtgtctacccccaggctg
cagtattatgacaaggttttacgactactagatgtcattggtttgcctgaactggttatt
cagttggctacatcagccataactgaagcaggtgatgactggaaaagtcaggctactcta
aggacatgtattttcaaacatcatttggatttgggtcacaatagccaagcatatgaagcc
ttaacccaaattcctgattccagcaggcaattagattgtttacggcagttggtggtagtt
ctttgtgaacgctcacagctacaggatcttgtagagtttccctatgtgaatctgcataat
gaggttgtgggaataattgagtcacgtgctagagctgtggaccttatgactcacaattac
tatgaacttctgtatgcctttcacatctatcgccacaattaccgcaaggctggcacagtg
atgtttgagtatggaatgcggcttggcagagaagttcgaactctccggggacttgagaaa
caaggcaactgttatctggctgctctcaattgtttacgacttattcgtccagaatatgcg
tggattgtgcagccagtgtctggtgcagtgtatgatcgccctggagcatcccctaagagg
aatcatgatggagaatgcacagctgcccccacaaatcgacaaattgaaatcctggaactg
gaagatctggagaaagagtgttccttggctcgcatccgcctcactttggctcagcatgat
ccatcagcggttgcagttgctggaagttcatcagcagaggaaatggtcactctcttggtt
caggcgggcctctttgacactgccatatcactctgtcagacttttaagcttcccttaacg
ccagtctttgaagggcttgccttcaaatgcatcaaattgcaatttggaggagaggcagca
caagcagaagcctgggcctggctagcagccaatcagctctcatctgtcatcactactaag
gagtctagtgctacagatgaagcatggcgactattatccacttacctggagaggtacaaa
gtccagaataacttgtatcaccactgtgtaatcaacaagctcttgtctcatggagtgcct
ctgcctaattggcttataaacagttacaagaaggttgatgctgctgaattgcttcgttta
tacttaaactatgaccttttagaagaagctgtggatttggtgtcagaatatgtggatgct
gtattgggaaaaggacatcaatacttcggaattgagtttccactgtccgcaacagcccca
atggtgtggcttccatactcctctattgatcagcttctccaagctctgggagagaacagt
gccaacagtcacaacatcgcactgtcccagaaaatacttgacaaattggaggactaccag
caaaaagttgataaggcaacacgggatttattatatcgtcggaccttgtga

DBGET integrated database retrieval system