KEGG   Homo sapiens (human): 23285Help
Entry
23285             CDS       T01001                                 

Definition
(RefSeq) KIAA1107
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: DUF4596
Motif
Other DBs
NCBI-GeneID: 23285
NCBI-ProteinID: NP_056052
HGNC: 29192
Ensembl: ENSG00000069712
Vega: OTTHUMG00000010289
UniProt: Q9UPP5 A0A1B0GWG1 B4DYL8
Position
1p22.1
AA seq 1279 aa AA seqDB search
MSTDDQQKIQAAAFDKGDDRRLGKKPIFSSSQQRKQVSDSGDIKIKSWRGNNKKECWSYL
STNKKMKSDGLGASGHSSSTNRNSINKTLKQDDVKEKDGTKIASKITKELKTGGKNVSGK
PKTVTKSKTENGDKARLENMSPRQVVERSATAAAAATGQKNLLNGKGVRNQEGQISGARP
KVLTGNLNVQAKAKPLKKATGKDSPCLSIAGPSSRSTDSSMEFSISTECLDEPKENGSTE
EEKPSGHKLSFCDSPGQMMKNSVDSVKNSTVAIKSRPVSRVTNGTSNKKSIHEQDTNVNN
SVLKKVSGKGCSEPVPQAILKKRGTSNGCTAAQQRTKSTPSNLTKTQGSQGESPNSVKSS
VSSRQSDENVAKLDHNTTTEKQAPKRKMVKQVHTALPKVNAKIVAMPKNLNQSKKGETLN
NKDSKQKMPPGQVISKTQPSSQRPLKHETSTVQKSMFHDVRDNNNKDSVSEQKPHKPLIN
LASEISDAEALQSSCRPDPQKPLNDQEKEKLALECQNISKLDKSLKHELESKQICLDKSE
TKFPNHKETDDCDAANICCHSVGSDNVNSKFYSTTALKYMVSNPNENSLNSNPVCDLDST
SAGQIHLISDRENQVGRKDTNKQSSIKCVEDVSLCNPERTNGTLNSAQEDKKSKVPVEGL
TIPSKLSDESAMDEDKHATADSDVSSKCFSGQLSEKNSPKNMETSESPESHETPETPFVG
HWNLSTGVLHQRESPESDTGSATTSSDDIKPRSEDYDAGGSQDDDGSNDRGISKCGTMLC
HDFLGRSSSDTSTPEELKIYDSNLRIEVKMKKQSNNDLFQVNSTSDDEIPRKRPEIWSRS
AIVHSRERENIPRGSVQFAQEIDQVSSSADETEDERSEAENVAENFSISNPAPQQFQGII
NLAFEDATENECREFSATKKFKRSVLLSVDECEELGSDEGEVHTPFQASVDSFSPSDVFD
GISHEHHGRTCYSRFSRESEDNILECKQNKGNSVCKNESTVLDLSSIDSSRKNKQSVSAT
EKKNTIDVLSSRSRQLLREDKKVNNGSNVENDIQQRSKFLDSDVKSQERPCHLDLHQREP
NSDIPKNSSTKSLDSFRSQVLPQEGPVKESHSTTTEKANIALSAGDIDDCDTLAQTRMYD
HRPSKTLSPIYEMDVIEAFEQKVESETHVTDMDFEDDQHFAKQDWTLLKQLLSEQDSNLD
VTNSVPEDLSLAQYLINQTLLLARDSSKPQGITHIDTLNRWSELTSPLDSSASITMASFS
SEDCSPQGEWTILELETQH
NT seq 3840 nt NT seq  +upstreamnt  +downstreamnt
atgagcacagatgatcaacagaaaatccaagcagctgcatttgacaaaggtgatgatcga
agacttggcaaaaagcctatattcagtagctcgcagcaaaggaaacaagtttctgactct
ggtgatataaaaatcaaatcttggaggggaaataacaagaaagagtgttggagttatctc
tctactaataaaaagatgaaatctgatggattaggagcatctggacattcgtcaagtacc
aatagaaatagtataaataaaactctgaagcaagatgatgtaaaggaaaaagatggtaca
aaaatagcatctaagattacaaaagaactaaaaactgggggaaaaaatgtttctggaaag
cccaaaactgtaacaaaatccaaaacagaaaatggtgataaggcacggttggaaaacatg
tcacctagacaagttgtagaaagatcagcaacagcagcagcagcagcaactggacagaag
aatttactaaatggaaaaggagtgagaaatcaggaagggcaaatttcaggtgccagaccc
aaggtactcacaggaaacttaaatgtgcaagccaaagcaaagcctttgaagaaagctaca
gggaaggattcaccatgcctcagcatcgcaggaccctccagcagatccacagattcaagt
atggaattctcaatttccactgaatgtctggatgaaccgaaagaaaatggatcaacagaa
gaagaaaagccttctggacataaactatccttttgtgattctccaggacagatgatgaaa
aacagtgtagatagtgtcaaaaattccactgtagccataaaatctcgacctgtttcaaga
gttaccaatggaacttccaataaaaaaagtattcatgaacaagacactaatgtaaataac
agtgtactaaagaaagtcagtggcaaaggatgtagtgagccagtaccacaggcaattttg
aagaaaagaggaactagcaatggatgtactgcagctcagcagaggacaaagagtacccca
tctaatcttactaaaactcaaggatcccaaggagagtcaccaaactcagtaaaatcttca
gtctcttcaaggcagtctgatgaaaatgtggcaaagttggaccacaatacaactacagag
aaacaagcacctaagagaaaaatggtcaagcaagtacacacagctttgcctaaggttaat
gcaaaaatagtggcaatgcctaaaaatctaaatcagtcaaagaaaggtgaaactttgaat
aataaagattcaaaacagaaaatgcctcctggacaggttatatcaaaaactcagccttcc
tcccaaagacctttaaaacatgaaacatctactgtccaaaaaagtatgtttcatgatgtg
cgtgataataacaacaaggacagtgtttctgaacagaagcctcacaaacctctcattaat
cttgcatctgaaataagtgatgcagaagcactccagtcatcctgcaggcctgacccacaa
aagccattaaacgatcaagaaaaagagaagttggcgttagaatgccaaaatatttcaaag
ctggataaatcattaaaacacgaactggaatcaaaacagatttgtttagataaaagtgaa
acaaaatttcccaatcacaaagaaacagatgattgcgatgcagctaacatatgttgtcat
tctgttgggagtgataatgtaaattcaaaattttatagcaccacagccctaaaatacatg
gtttcaaatccaaatgaaaactccttgaactctaatccagtttgtgatttagactcaaca
agtgcagggcaaatccatttgatatcagatagggagaaccaagtagggagaaaagataca
aacaaacaatcaagtattaaatgtgtggaagatgtttcactgtgtaatcctgaaaggaca
aatggtaccttaaattctgctcaagaagacaaaaaatcgaaagttcctgtggaaggactg
acaattcctagtaagttgtcagatgaatctgctatggatgaagacaaacatgctacagca
gactcagatgtatcttccaagtgtttttcgggacagctatcagaaaaaaattctcctaaa
aatatggaaacatcagaatctccagagagccatgaaactccagaaactccatttgtgggt
cactggaatttgagtactggtgttctgcatcagcgagagagtcctgaatctgacactggc
agtgctaccacctcctccgatgacataaagcccagatctgaagactatgatgctggaggg
tctcaggatgatgatgggtcaaatgacagaggtatctctaaatgtggcactatgctgtgc
catgattttcttggaagaagtagcagtgataccagtactcctgaagaattaaaaatttat
gatagtaatttaagaattgaagtaaaaatgaaaaagcaaagtaataatgatcttttccaa
gttaattcaacgagtgatgatgaaatccctaggaaaaggccagaaatttggtctcgatct
gcaatagttcactctagggaaagagaaaatattccacgaggcagtgtccagtttgctcag
gaaatagatcaggtatcttcttcagcagatgaaacagaagatgaaagatctgaagctgaa
aacgttgcagaaaatttctctatatctaacccagctcctcagcagtttcagggaataatt
aatttagcttttgaagatgcaactgaaaatgaatgtcgtgaattttctgcaactaaaaag
tttaaaaggtcagttttactttcagtcgatgaatgtgaagagctgggatcagatgaagga
gaagtccatactccctttcaggcttctgtagattctttttcaccttctgatgtttttgat
ggcatttctcatgaacatcatggaaggacctgctattccagattctcacgagaaagtgaa
gataatattttagaatgtaaacaaaataaaggcaatagtgtatgtaaaaatgaaagcact
gtcttggatcttagtagcattgactcttcaagaaaaaataaacagagtgtttcagccaca
gaaaaaaagaacacaatagacgtcctatccagtagaagcagacagcttcttcgagaagat
aaaaaagtaaacaatggaagcaatgtggaaaatgacattcagcaacgcagcaaattcttg
gatagtgatgtaaaatctcaagaaagaccatgtcacttggatcttcatcaaagagaaccc
aattctgacataccaaagaacagctctacaaaatctctagactcctttcggagtcaagtt
ctgcctcaggaaggtccagtgaaagagagccattctacaactactgaaaaagctaatatt
gctttatctgcaggagacatagatgattgtgacacactggcacaaacccgcatgtatgac
catcggccttcaaaaaccctgtctccaatatatgagatggatgtaatagaagcatttgag
cagaaagtggaatcagaaacacatgttacagatatggattttgaagatgaccaacatttt
gcaaaacaagattggacactactaaagcaactgctctctgaacaggattcaaacttagat
gttacaaattccgttcctgaagacttaagtttagcacagtatctaatcaatcagacacta
cttttagcacgagatagctcaaaacctcagggtataacacatattgacactttgaacaga
tggagtgaactaacatctccacttgattcctcagcgagcatcaccatggctagtttttcc
tctgaagattgttcgcctcaaggcgagtggacaattctggaactggaaactcagcattaa

DBGET integrated database retrieval system