KEGG   Homo sapiens (human): 23291Help
Entry
23291             CDS       T01001                                 

Gene name
FBXW11, BTRC2, BTRCP2, FBW1B, FBXW1B, Fbw11, Hos
Definition
F-box and WD repeat domain containing 11
Orthology
K03362  
F-box and WD-40 domain protein 1/11
Organism
hsa  Homo sapiens (human)
Pathway
Oocyte meiosis
Ubiquitin mediated proteolysis
Wnt signaling pathway
Hedgehog signaling pathway
Hippo signaling pathway
Circadian rhythm
Shigellosis
Module
SCF-BTRC complex
Class
Genetic Information Processing; Folding, sorting and degradation; Ubiquitin mediated proteolysis [PATH:hsa04120]
Environmental Information Processing; Signal transduction; Wnt signaling pathway [PATH:hsa04310]
Environmental Information Processing; Signal transduction; Hedgehog signaling pathway [PATH:hsa04340]
Environmental Information Processing; Signal transduction; Hippo signaling pathway [PATH:hsa04390]
Cellular Processes; Cell growth and death; Oocyte meiosis [PATH:hsa04114]
Organismal Systems; Environmental adaptation; Circadian rhythm [PATH:hsa04710]
Human Diseases; Infectious diseases; Shigellosis [PATH:hsa05131]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
5q35.1
AA seq 542 aa AA seqDB search
MEPDSVIEDKTIELMCSVPRSLWLGCANLVESMCALSCLQSMPSVRCLQISNGTSSVIVS
RKRPSEGNYQKEKDLCIKYFDQWSESDQVEFVEHLISRMCHYQHGHINSYLKPMLQRDFI
TALPEQGLDHIAENILSYLDARSLCAAELVCKEWQRVISEGMLWKKLIERMVRTDPLWKG
LSERRGWDQYLFKNRPTDGPPNSFYRSLYPKIIQDIETIESNWRCGRHNLQRIQCRSENS
KGVYCLQYDDEKIISGLRDNSIKIWDKTSLECLKVLTGHTGSVLCLQYDERVIVTGSSDS
TVRVWDVNTGEVLNTLIHHNEAVLHLRFSNGLMVTCSKDRSIAVWDMASATDITLRRVLV
GHRAAVNVVDFDDKYIVSASGDRTIKVWSTSTCEFVRTLNGHKRGIACLQYRDRLVVSGS
SDNTIRLWDIECGACLRVLEGHEELVRCIRFDNKRIVSGAYDGKIKVWDLQAALDPRAPA
STLCLRTLVEHSGRVFRLQFDEFQIISSSHDDTILIWDFLNVPPSAQNETRSPSRTYTYI
SR
NT seq 1629 nt NT seq  +upstreamnt  +downstreamnt
atggagcccgactcggtgattgaggacaagaccatcgagctcatgtgttctgtgccaagg
tctttgtggctaggctgcgccaacctggtagagagcatgtgcgcactgagttgcctgcag
agcatgcccagtgtcagatgtctccagataagtaatggaacatcatctgtgatcgtctcc
agaaagaggccatcagaaggaaactatcaaaaagaaaaagacttgtgtattaaatatttt
gaccagtggtctgaatcagatcaagtggaatttgtggaacatcttatttcacgaatgtgt
cattatcagcatggacatattaactcttacctgaagcccatgttgcagcgggactttatt
accgctttaccagagcaaggcttagatcacatagcagaaaacattctttcgtacctggat
gccaggtctctgtgtgcagcagagctggtatgtaaagaatggcagcgagtgatctcagaa
ggaatgctttggaagaagctgattgaacgaatggtacgcactgatcccctatggaaagga
ctttcagaaagaagagggtgggatcagtacctgtttaaaaacagacccacagatggccct
ccaaattcattttataggtcattatacccaaagattatccaggatatagagactatagaa
tctaactggcggtgtggacgacacaacttgcagaggattcagtgccgctctgaaaatagt
aaaggtgtctactgtttacagtacgatgatgaaaaaattatcagtggcctacgagataat
tctattaagatatgggataaaaccagcctggaatgtttgaaagtgttaacaggacacaca
ggctctgtcctctgtctgcagtatgatgagcgtgtcattgtaactggctcttcagattct
acggtgagagtgtgggatgtgaacacgggtgaagttcttaacacattgatccaccacaat
gaggctgtattgcacttacgcttcagcaatggactgatggtgacctgttccaaggaccgc
tccattgctgtgtgggacatggcttctgcgaccgacatcactttacgccgtgtcctggtt
ggccaccgggctgccgtcaatgtagtagactttgacgacaagtacatcgtgtctgcctct
ggtgacaggaccatcaaagtctggagcacgagcacctgtgaatttgttcgtactctcaat
gggcacaagcggggcattgcctgtctccagtacagggatcgcctggttgttagtggatca
tcagataataccattaggctctgggatattgaatgtggtgcctgtttaagagtcctagag
ggacatgaagaattggtccgatgcatccggtttgataacaagaggattgtcagtggggcc
tatgatgggaaaattaaagtttgggacttgcaagctgctcttgaccctcgagccccagca
agcacattgtgtttgcgcacattggtggaacattctggacgtgtgtttcggctccagttt
gatgagtttcagatcatcagcagctcccatgatgacactattttgatttgggatttctta
aatgtgcctcccagtgcccagaatgagacccgttctccctccagaacatacacttacatc
tctagataa

DBGET integrated database retrieval system