KEGG   Homo sapiens (human): 23291Help
Entry
23291             CDS       T01001                                 

Gene name
FBXW11, BTRC2, BTRCP2, FBW1B, FBXW1B, Fbw11, Hos
Definition
F-box and WD repeat domain containing 11
Orthology
K03362  
F-box and WD-40 domain protein 1/11
Organism
hsa  Homo sapiens (human)
Pathway
Oocyte meiosis
Ubiquitin mediated proteolysis
Wnt signaling pathway
Hedgehog signaling pathway
Hippo signaling pathway
Circadian rhythm
Shigellosis
Module
SCF-BTRC complex
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    23291 (FBXW11)
 Environmental Information Processing
  Signal transduction
   04310 Wnt signaling pathway
    23291 (FBXW11)
   04340 Hedgehog signaling pathway
    23291 (FBXW11)
   04390 Hippo signaling pathway
    23291 (FBXW11)
 Cellular Processes
  Cell growth and death
   04114 Oocyte meiosis
    23291 (FBXW11)
 Organismal Systems
  Environmental adaptation
   04710 Circadian rhythm
    23291 (FBXW11)
 Human Diseases
  Infectious diseases
   05131 Shigellosis
    23291 (FBXW11)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  multi subunit Ring-finger type E3
   SCF complex
    target recognizing subunit (F-box)
     23291 (FBXW11)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
5q35.1
AA seq 542 aa AA seqDB search
MEPDSVIEDKTIELMCSVPRSLWLGCANLVESMCALSCLQSMPSVRCLQISNGTSSVIVS
RKRPSEGNYQKEKDLCIKYFDQWSESDQVEFVEHLISRMCHYQHGHINSYLKPMLQRDFI
TALPEQGLDHIAENILSYLDARSLCAAELVCKEWQRVISEGMLWKKLIERMVRTDPLWKG
LSERRGWDQYLFKNRPTDGPPNSFYRSLYPKIIQDIETIESNWRCGRHNLQRIQCRSENS
KGVYCLQYDDEKIISGLRDNSIKIWDKTSLECLKVLTGHTGSVLCLQYDERVIVTGSSDS
TVRVWDVNTGEVLNTLIHHNEAVLHLRFSNGLMVTCSKDRSIAVWDMASATDITLRRVLV
GHRAAVNVVDFDDKYIVSASGDRTIKVWSTSTCEFVRTLNGHKRGIACLQYRDRLVVSGS
SDNTIRLWDIECGACLRVLEGHEELVRCIRFDNKRIVSGAYDGKIKVWDLQAALDPRAPA
STLCLRTLVEHSGRVFRLQFDEFQIISSSHDDTILIWDFLNVPPSAQNETRSPSRTYTYI
SR
NT seq 1629 nt NT seq  +upstreamnt  +downstreamnt
atggagcccgactcggtgattgaggacaagaccatcgagctcatgtgttctgtgccaagg
tctttgtggctaggctgcgccaacctggtagagagcatgtgcgcactgagttgcctgcag
agcatgcccagtgtcagatgtctccagataagtaatggaacatcatctgtgatcgtctcc
agaaagaggccatcagaaggaaactatcaaaaagaaaaagacttgtgtattaaatatttt
gaccagtggtctgaatcagatcaagtggaatttgtggaacatcttatttcacgaatgtgt
cattatcagcatggacatattaactcttacctgaagcccatgttgcagcgggactttatt
accgctttaccagagcaaggcttagatcacatagcagaaaacattctttcgtacctggat
gccaggtctctgtgtgcagcagagctggtatgtaaagaatggcagcgagtgatctcagaa
ggaatgctttggaagaagctgattgaacgaatggtacgcactgatcccctatggaaagga
ctttcagaaagaagagggtgggatcagtacctgtttaaaaacagacccacagatggccct
ccaaattcattttataggtcattatacccaaagattatccaggatatagagactatagaa
tctaactggcggtgtggacgacacaacttgcagaggattcagtgccgctctgaaaatagt
aaaggtgtctactgtttacagtacgatgatgaaaaaattatcagtggcctacgagataat
tctattaagatatgggataaaaccagcctggaatgtttgaaagtgttaacaggacacaca
ggctctgtcctctgtctgcagtatgatgagcgtgtcattgtaactggctcttcagattct
acggtgagagtgtgggatgtgaacacgggtgaagttcttaacacattgatccaccacaat
gaggctgtattgcacttacgcttcagcaatggactgatggtgacctgttccaaggaccgc
tccattgctgtgtgggacatggcttctgcgaccgacatcactttacgccgtgtcctggtt
ggccaccgggctgccgtcaatgtagtagactttgacgacaagtacatcgtgtctgcctct
ggtgacaggaccatcaaagtctggagcacgagcacctgtgaatttgttcgtactctcaat
gggcacaagcggggcattgcctgtctccagtacagggatcgcctggttgttagtggatca
tcagataataccattaggctctgggatattgaatgtggtgcctgtttaagagtcctagag
ggacatgaagaattggtccgatgcatccggtttgataacaagaggattgtcagtggggcc
tatgatgggaaaattaaagtttgggacttgcaagctgctcttgaccctcgagccccagca
agcacattgtgtttgcgcacattggtggaacattctggacgtgtgtttcggctccagttt
gatgagtttcagatcatcagcagctcccatgatgacactattttgatttgggatttctta
aatgtgcctcccagtgcccagaatgagacccgttctccctccagaacatacacttacatc
tctagataa

DBGET integrated database retrieval system