KEGG   Homo sapiens (human): 23293Help
Entry
23293             CDS       T01001                                 

Gene name
SMG6, C17orf31, EST1A, SMG-6, hSMG5/7a
Definition
(RefSeq) SMG6, nonsense mediated mRNA decay factor (EC:3.1.-.-)
  KO
K11124  
protein SMG6 [EC:3.1.-.-]
Organism
hsa  Homo sapiens (human)
Pathway
mRNA surveillance pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Translation
   03015 mRNA surveillance pathway
    23293 (SMG6)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.-  Acting on ester bonds
    3.1.-.-  
     23293 (SMG6)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Surveillance factors
    Other surveillance  factors
     23293 (SMG6)
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     23293 (SMG6)
DNA replication proteins [BR:hsa03032]
 Eukaryotic Type
  DNA Replication Termination Factors
   Telomerase complex (animals)
    23293 (SMG6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
17p13.3
AA seq 1419 aa AA seqDB search
MAEGLERVRISASELRGILATLAPQAGSRENMKELKEARPRKDNRRPDLEIYKPGLSRLR
NKPKIKEPPGSEEFKDEIVNDRDCSAVENGTQPVKDVCKELNNQEQNGPIDPENNRGQES
FPRTAGQEDRSLKIIKRTKKPDLQIYQPGRRLQTVSKESASRVEEEEVLNQVEQLRVEED
ECRGNVAKEEVANKPDRAEIEKSPGGGRVGAAKGEKGKRMGKGEGVRETHDDPARGRPGS
AKRYSRSDKRRNRYRTRSTSSAGSNNSAEGAGLTDNGCRRRRQDRTKERPRLKKQVSVSS
TDSLDEDRIDEPDGLGPRRSSERKRHLERNWSGRGEGEQKNSAKEYRGTLRVTFDAEAMN
KESPMVRSARDDMDRGKPDKGLSSGGKGSEKQESKNPKQELRGRGRGILILPAHTTLSVN
SAGSPESAPLGPRLLFGSGSKGSRSWGRGGTTRRLWDPNNPDQKPALKTQTPQLHFLDTD
DEVSPTSWGDSRQAQASYYKFQNSDNPYYYPRTPGPASQYPYTGYNPLQYPVGPTNGVYP
GPYYPGYPTPSGQYVCSPLPTSTMSPEEVEQHMRNLQQQELHRLLRVADNQELQLSNLLS
RDRISPEGLEKMAQLRAELLQLYERCILLDIEFSDNQNVDQILWKNAFYQVIEKFRQLVK
DPNVENPEQIRNRLLELLDEGSDFFDSLLQKLQVTYKFKLEDYMDGLAIRSKPLRKTVKY
ALISAQRCMICQGDIARYREQASDTANYGKARSWYLKAQHIAPKNGRPYNQLALLAVYTR
RKLDAVYYYMRSLAASNPILTAKESLMSLFEETKRKAEQMEKKQHEEFDLSPDQWRKGKK
STFRHVGDDTTRLEIWIHPSHPRSSQGTESGKDSEQENGLGSLSPSDLNKRFILSFLHAH
GKLFTRIGMETFPAVAEKVLKEFQVLLQHSPSPIGSTRMLQLMTINMFAVHNSQLKDCFS
EECRSVIQEQAAALGLAMFSLLVRRCTCLLKESAKAQLSSPEDQDDQDDIKVSSFVPDLK
ELLPSVKVWSDWMLGYPDTWNPPPTSLDLPSHVAVDVWSTLADFCNILTAVNQSEVPLYK
DPDDDLTLLILEEDRLLSGFVPLLAAPQDPCYVEKTSDKVIAADCKRVTVLKYFLEALCG
QEEPLLAFKGGKYVSVAPVPDTMGKEMGSQEGTRLEDEEEDVVIEDFEEDSEAEGSGGED
DIRELRAKKLALARKIAEQQRRQEKIQAVLEDHSQMRQMELEIRPLFLVPDTNGFIDHLA
SLARLLESRKYILVVPLIVINELDGLAKGQETDHRAGGYARVVQEKARKSIEFLEQRFES
RDSCLRALTSRGNELESIAFRSEDITGQLGNNDDLILSCCLHYCKDKAKDFMPASKEEPI
RLLREVVLLTDDRNLRVKALTRNVPVRDIPAFLTWAQVG
NT seq 4260 nt NT seq  +upstreamnt  +downstreamnt
atggcggaagggctggagcgtgtgcggatctccgcgtcggagctgcgcgggatcctggct
actctggccccgcaggccgggagcagagaaaacatgaaggaattaaaggaggccaggccg
cgcaaagataacaggcgtccagatctggaaatctataagcctggcctttctcggctaagg
aacaagcccaaaatcaaggaaccccctgggagtgaggaattcaaagatgaaattgttaat
gaccgagattgctctgctgttgaaaatggtacacagcccgttaaagatgtctgcaaggaa
ctgaacaaccaagagcagaatggtcctatagacccagaaaataatcggggacaagaatcc
tttcctaggactgctggacaagaggatcgtagtctaaaaattatcaaaagaacaaagaaa
cccgacctgcagatctatcagcctggacgacgtttgcagactgttagcaaagaatccgcc
agtcgggtggaggaggaagaagtcctcaaccaggtagaacaactgagagtagaggaagat
gagtgtaggggaaatgttgcgaaggaggaagttgcgaataaaccagacagggctgagata
gaaaagagcccaggtggtgggagagtaggggctgcaaaaggagaaaaaggaaagaggatg
ggaaaaggggagggggtgagggaaacccacgacgacccagcccgcgggaggccgggctcc
gcaaagcgctactcccgctcagacaaacgaaggaatcgctaccgcacgcgcagcaccagc
tcagctggcagcaacaacagcgctgagggagctggcctgacggataatggatgtcgccgc
cgccgacaggataggaccaaggagaggccacgactgaagaagcaagtgtctgtgtcctca
accgattccttagacgaggacagaattgatgagcctgatggattaggacccaggagaagt
tcagaaaggaagagacatttagaaagaaactggtctggccgtggggagggtgagcagaaa
aacagtgctaaagaatatcgaggcactcttcgtgtcactttcgatgcagaagccatgaac
aaagagtctcccatggtgaggtcagccagggatgatatggatagaggaaagcctgacaaa
ggcttgagcagtgggggcaaaggctctgagaagcaggagtccaaaaacccgaaacaagaa
cttcggggtcgtggtcgtggcattctgattttgcctgcccataccaccctatctgtcaat
tcagcaggttctccagagtccgcgcctttgggacctcggcttttgtttggatctggtagt
aagggatctcggagttggggccgtggaggcaccacacgccgattgtgggacccaaacaat
cctgatcagaaacctgctctaaagactcagacgccccagctacatttcttggacactgat
gatgaagtcagccctacatcttggggtgactcacgccaggctcaggcatcttactataag
tttcaaaactctgacaacccctattattacccccggacaccaggccctgcctcccagtat
ccctatacgggctataaccctctacagtacccagtgggccctacgaatggtgtgtaccca
gggccttactacccaggctacccgactccgtcaggacagtatgtgtgtagccctctacct
accagcaccatgagtcccgaggaggtagagcagcacatgaggaacctgcagcaacaggag
ctgcacaggcttctccgggtggctgacaaccaggaactgcagctcagcaacctgctctcc
agggaccgcatcagtccggagggcctggagaagatggcgcaactcagagctgaactgctg
cagctatatgagcgctgtattctattagatattgagttctctgataatcagaatgtggat
cagatcctgtggaagaatgctttctatcaggtgattgagaagttcaggcaacttgtcaag
gatccgaatgttgagaacccagaacagattcggaacagacttttggagctcttggatgag
ggtagtgacttctttgatagtttgcttcagaagctgcaggttacttacaagttcaaactg
gaagactacatggatggtcttgccattcgcagcaagccattacgcaagacagtaaaatat
gccttgatcagtgcccagcgatgcatgatatgccaaggagatattgctaggtaccgggag
caagccagtgatacagcgaattatgggaaagcacgcagttggtacctgaaggcccagcac
attgctcccaagaatgggcgcccctataaccagttggctttgctggcagtgtatacgagg
aggaagcttgacgctgtctattactatatgcgcagtttagctgccagcaaccctatcctg
actgccaaggagagtctcatgagcttgtttgaagagaccaagcggaaggcagaacagatg
gaaaagaagcaacatgaggaatttgacctgagccctgaccagtggcggaaaggaaagaag
tctactttccggcatgttggagatgacaccactcgcctggagatctggattcatccatcc
catccacggtcttcccagggcactgagtctgggaaggattctgagcaagagaatgggctg
ggcagcctgagtcccagtgatctgaacaaaaggttcatcctcagttttctccatgcccat
gggaagctgtttacccggattgggatggagacattccctgcagtggctgagaaggtcctc
aaggagttccaggtgttactgcagcacagcccctctcccattggaagtacccgcatgctg
cagcttatgaccatcaatatgtttgcagtacacaactcccagctgaaagactgcttctcg
gaggagtgccgctctgtgatccaggaacaagccgcagctctgggcttggccatgttttct
ctactggtccgccgctgcacctgcttacttaaggagtccgccaaagctcagctgtcctct
cctgaggaccaggatgaccaagacgacatcaaggtgtcttcctttgtcccggacctgaag
gagctgctccccagtgtcaaagtctggtcagattggatgctcggctacccggacacctgg
aatcctcctcccacatccctggatctgccctcgcatgttgctgtggatgtatggtcgacg
ctggctgatttctgtaacatactgactgcagtgaatcagtctgaggtgccactgtacaag
gacccggatgatgacctcacccttcttatcctggaagaggatcggcttctctcgggcttt
gtccccttgctggctgcccctcaggacccctgctacgtggagaaaacctcggataaggtt
attgcagctgactgcaaaagggtcacagtgctgaagtattttctggaagccctttgtgga
caagaagagcctctgctggcattcaagggtggaaagtatgtgtcagtggcacccgtccca
gacaccatgggaaaggaaatgggaagccaagagggaacacgactggaagatgaggaggag
gatgtggtgattgaagactttgaggaagattcagaggctgaaggcagcggaggcgaggat
gacatcagggagcttcgggccaagaagctggctctggccaggaagatagctgagcagcag
cgtcgccaggaaaagatccaggctgtcctggaggaccacagtcagatgaggcagatggag
ctcgaaatcagacctttgttcctcgtaccagacaccaacggcttcattgaccacctggcc
agtctggcgcggctgctggagagcaggaagtacatcctggtggtgcccctcatcgtgatc
aatgagctggacggcctggccaaggggcaggagacagaccaccgggctgggggctacgcc
cgtgtggtacaagagaaggcccgcaagtccatcgagttcctcgagcagcgattcgagagt
cgggactcttgcctgcgagccctgaccagccgtggcaatgaactcgaatccatcgccttc
cgcagtgaggacatcactggccagctgggtaacaacgatgatctcatcctgtcctgctgc
ctccactactgcaaagacaaggctaaggacttcatgcccgccagcaaagaggagccaatc
cggctactgcgggaggtggtgctgttgacggatgaccggaacctgcgtgtgaaggcgctc
acaaggaatgttcctgtacgggacatcccagccttcctcacgtgggcccaggtgggctga

DBGET integrated database retrieval system