KEGG   Homo sapiens (human): 23295Help
Entry
23295             CDS       T01001                                 

Gene name
MGRN1, RNF156
Definition
mahogunin ring finger 1, E3 ubiquitin protein ligase (EC:6.3.2.-)
Orthology
K10604  
E3 ubiquitin-protein ligase MGRN1 [EC:6.3.2.19]
Organism
hsa  Homo sapiens (human)
Pathway
Ubiquitin mediated proteolysis
Class
Genetic Information Processing; Folding, sorting and degradation; Ubiquitin mediated proteolysis [PATH:hsa04120]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
16p13.3
AA seq 554 aa AA seqDB search
MGSILSRRIAGVEDIDIQANSAYRYPPKSGNYFASHFFMGGEKFDTPHPEGYLFGENMDL
NFLGSRPVQFPYVTPAPHEPVKTLRSLVNIRKDSLRLVRYKDDADSPTEDGDKPRVLYSL
EFTFDADARVAITIYCQASEEFLNGRAVYSPKSPSLQSETVHYKRGVSQQFSLPSFKIDF
SEWKDDELNFDLDRGVFPVVIQAVVDEGDVVEVTGHAHVLLAAFEKHMDGSFSVKPLKQK
QIVDRVSYLLQEIYGIENKNNQETKPSDDENSDNSNECVVCLSDLRDTLILPCRHLCLCT
SCADTLRYQANNCPICRLPFRALLQIRAVRKKPGALSPVSFSPVLAQSLEHDEHSNSDSV
PPGYEPISLLEALNGLRAVSPAIPSAPLYEEITYSGISDGLSQASCPLAAIDHILDSSRQ
KGRPQSKAPDSTLRSPSSPIHEEDEEKLSEDVDAPPPLGGAELALRESSSPESFITEEVD
ESSSPQQGTRAASIENVLQDSSPEHCGRGPPADIYLPGRPTSMETAHGLATTSPTWPPLG
GPSPDPSAAELTPL
NT seq 1665 nt NT seq  +upstreamnt  +downstreamnt
atgggctccattctcagccgccgcatcgcgggggtggaggacatcgacatccaggcgaac
tcggcctatcgctaccctccgaagtccggaaactactttgcttcgcactttttcatggga
ggagagaaattcgacaccccccaccctgaaggttacctctttggagagaacatggatctg
aacttcctgggcagccgcccggtccagtttccctacgtcactcctgccccccacgagccc
gtgaagacgctgcggagcctggtgaacatccgcaaagactccctgcggctggtgaggtac
aaagacgatgccgacagccccaccgaggacggcgacaagccccgggtgctctacagcctg
gagttcaccttcgacgccgatgcccgcgtggccatcaccatctactgccaggcatcggag
gagttcctgaacggcagggcagtatacagccccaagagcccctcgctacagtccgagacc
gtccactacaagagaggggtgagccagcagttctccctgccctccttcaagattgacttc
tcggaatggaaggatgacgagctgaactttgacctggaccggggcgtgtttccagtagtc
atccaggctgtggtggacgaaggagatgtggtggaagtgactggccacgcccacgtgctc
ttggctgcctttgaaaagcacatggacggcagcttctctgtgaagcctttaaagcagaag
caaattgtggaccgggtcagctacctcctgcaggagatctatggcattgagaacaagaac
aaccaggagaccaagccctcggacgacgagaacagcgacaacagcaacgagtgtgtggtg
tgcctgtccgacctgcgggacacgctgatcctgccctgccgccacctgtgcctctgtacc
tcctgcgccgacacgctgcgctaccaggccaacaactgccccatctgccggctgcctttc
cgggccctcctgcagatccgggcggtgcggaagaagccaggagccctgtcccccgtgtcc
ttcagccccgtcctggcccagagcctggagcatgatgagcactctaactctgacagcgtc
ccacctggctacgagcccatctcgctgctcgaggcgctcaacggcctccgggctgtctcc
ccggccatcccctcggcccctctttatgaagaaatcacctattcaggcatctcggacggc
ctgtcccaggccagctgtcccctcgcggctatcgaccacatcctggacagcagccgccag
aagggcaggccgcagagcaaggcccccgacagcaccctacggtccccgtcttcccccatc
cacgaagaggatgaggagaagctctccgaggacgtggacgcccctcccccactgggtggc
gcagagctggccctgcgggaaagcagctcccctgagagtttcataacagaagaggttgat
gagtcgtcgtcaccacagcaagggacccgagcagcttccattgagaatgtcctgcaggac
agcagccccgagcactgtggccgaggcccacctgctgacatctacctgccaggacggccc
acctccatggagacggcccacggcctcgccaccaccagccccacctggcctccacttggt
ggccccagccccgatcccagcgccgccgagctgaccccactctga

DBGET integrated database retrieval system