KEGG   Homo sapiens (human): 23295Help
Entry
23295             CDS       T01001                                 

Gene name
MGRN1, RNF156
Definition
(RefSeq) mahogunin ring finger 1
  KO
K10604  
E3 ubiquitin-protein ligase MGRN1 [EC:2.3.2.27]
Organism
hsa  Homo sapiens (human)
Pathway
Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    23295 (MGRN1)
Enzymes [BR:hsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     23295 (MGRN1)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    23295 (MGRN1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
O60291(Tbio)
UniProt: 
Position
16p13.3
AA seq 552 aa AA seqDB search
MGSILSRRIAGVEDIDIQANSAYRYPPKSGNYFASHFFMGGEKFDTPHPEGYLFGENMDL
NFLGSRPVQFPYVTPAPHEPVKTLRSLVNIRKDSLRLVRYKDDADSPTEDGDKPRVLYSL
EFTFDADARVAITIYCQASEEFLNGRAVYSPKSPSLQSETVHYKRGVSQQFSLPSFKIDF
SEWKDDELNFDLDRGVFPVVIQAVVDEGDVVEVTGHAHVLLAAFEKHMDGSFSVKPLKQK
QIVDRVSYLLQEIYGIENKNNQETKPSDDENSDNSNECVVCLSDLRDTLILPCRHLCLCT
SCADTLRYQANNCPICRLPFRALLQIRAVRKKPGALSPVSFSPVLAQSLEHDEHSCPFKK
SKPHPASLASKKPKRETNSDSVPPGYEPISLLEALNGLRAVSPAIPSAPLYEEITYSGIS
DGLSQASCPLAAIDHILDSSRQKGRPQSKAPDSTLRSPSSPIHEEDEEKLSEDVDAPPPL
GGAELALRESSSPESFITEEVDESSSPQQGTRAASIENVLQDSSPEHCGRGPPADIYLPA
LGPDSCSVGIDE
NT seq 1659 nt NT seq  +upstreamnt  +downstreamnt
atgggctccattctcagccgccgcatcgcgggggtggaggacatcgacatccaggcgaac
tcggcctatcgctaccctccgaagtccggaaactactttgcttcgcactttttcatggga
ggagagaaattcgacaccccccaccctgaaggttacctctttggagagaacatggatctg
aacttcctgggcagccgcccggtccagtttccctacgtcactcctgccccccacgagccc
gtgaagacgctgcggagcctggtgaacatccgcaaagactccctgcggctggtgaggtac
aaagacgatgccgacagccccaccgaggacggcgacaagccccgggtgctctacagcctg
gagttcaccttcgacgccgatgcccgcgtggccatcaccatctactgccaggcatcggag
gagttcctgaacggcagggcagtatacagccccaagagcccctcgctacagtccgagacc
gtccactacaagagaggggtgagccagcagttctccctgccctccttcaagattgacttc
tcggaatggaaggatgacgagctgaactttgacctggaccggggcgtgtttccagtagtc
atccaggctgtggtggacgaaggagatgtggtggaagtgactggccacgcccacgtgctc
ttggctgcctttgaaaagcacatggacggcagcttctctgtgaagcctttaaagcagaag
caaattgtggaccgggtcagctacctcctgcaggagatctatggcattgagaacaagaac
aaccaggagaccaagccctcggacgacgagaacagcgacaacagcaacgagtgtgtggtg
tgcctgtccgacctgcgggacacgctgatcctgccctgccgccacctgtgcctctgtacc
tcctgcgccgacacgctgcgctaccaggccaacaactgccccatctgccggctgcctttc
cgggccctcctgcagatccgggcggtgcggaagaagccaggagccctgtcccccgtgtcc
ttcagccccgtcctggcccagagcctggagcatgatgagcactcttgtccctttaaaaaa
tcaaagccgcaccccgcctccctggccagcaagaaacctaaaagggaaacaaactctgac
agcgtcccacctggctacgagcccatctcgctgctcgaggcgctcaacggcctccgggct
gtctccccggccatcccctcggcccctctttatgaagaaatcacctattcaggcatctcg
gacggcctgtcccaggccagctgtcccctcgcggctatcgaccacatcctggacagcagc
cgccagaagggcaggccgcagagcaaggcccccgacagcaccctacggtccccgtcttcc
cccatccacgaagaggatgaggagaagctctccgaggacgtggacgcccctcccccactg
ggtggcgcagagctggccctgcgggaaagcagctcccctgagagtttcataacagaagag
gttgatgagtcgtcgtcaccacagcaagggacccgagcagcttccattgagaatgtcctg
caggacagcagccccgagcactgtggccgaggcccacctgctgacatctacctgccagcc
ctggggcccgactcctgctctgttggtatagacgagtaa

DBGET integrated database retrieval system