KEGG   Homo sapiens (human): 23305Help
Entry
23305             CDS       T01001                                 

Gene name
ACSL6, ACS2, FACL6, LACS_6, LACS2, LACS5
Definition
acyl-CoA synthetase long-chain family member 6 (EC:6.2.1.3)
Orthology
K01897  
long-chain acyl-CoA synthetase [EC:6.2.1.3]
Organism
hsa  Homo sapiens (human)
Pathway
Fatty acid degradation
Metabolic pathways
Fatty acid metabolism
PPAR signaling pathway
Peroxisome
Adipocytokine signaling pathway
Module
beta-Oxidation, acyl-CoA synthesis
Class
Metabolism; Overview; Fatty acid metabolism [PATH:hsa01212]
Metabolism; Lipid metabolism; Fatty acid degradation [PATH:hsa00071]
Cellular Processes; Transport and catabolism; Peroxisome [PATH:hsa04146]
Organismal Systems; Endocrine system; Adipocytokine signaling pathway [PATH:hsa04920]
Organismal Systems; Endocrine system; PPAR signaling pathway [PATH:hsa03320]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
5q31.1
AA seq 722 aa AA seqDB search
MLTFFLVSGGSLWLFVEFVLSLLEKMQTQEILRILRLPELGDLGQFFRSLSATTLVSMGA
LAAILAYWFTHRPKALQPPCNLLMQSEEVEDSGGARRSVIGSGPQLLTHYYDDARTMYQV
FRRGLSISGNGPCLGFRKPKQPYQWLSYQEVADRAEFLGSGLLQHNCKACTDQFIGVFAQ
NRPEWIIVELACYTYSMVVVPLYDTLGPGAIRYIINTADISTVIVDKPQKAVLLLEHVER
KETPGLKLIILMDPFEEALKERGQKCGVVIKSMQAVEDCGQENHQAPVPPQPDDLSIVCF
TSGTTGNPKGAMLTHGNVVADFSGFLKVTEKVIFPRQDDVLISFLPLAHMFERVIQSVVY
CHGGRVGFFQGDIRLLSDDMKALCPTIFPVVPRLLNRMYDKIFSQANTPLKRWLLEFAAK
RKQAEVRSGIIRNDSIWDELFFNKIQASLGGCVRMIVTGAAPASPTVLGFLRAALGCQVY
EGYGQTECTAGCTFTTPGDWTSGHVGAPLPCNHIKLVDVEELNYWACKGEGEICVRGPNV
FKGYLKDPDRTKEALDSDGWLHTGDIGKWLPAGTLKIIDRKKHIFKLAQGEYVAPEKIEN
IYIRSQPVAQIYVHGDSLKAFLVGIVVPDPEVMPSWAQKRGIEGTYADLCTNKDLKKAIL
EDMVRLGKESGLHSFEQVKAIHIHSDMFSVQNGLLTPTLKAKRPELREYFKKQIEELYSI
SM
NT seq 2169 nt NT seq  +upstreamnt  +downstreamnt
atgctgaccttcttcctcgtgtcggggggctccctctggctattcgtagagtttgtcctc
tcacttctggagaagatgcagacacaggagatcctgaggatactgcgactgcctgagcta
ggtgacttgggacagtttttccgcagcctctcggccaccaccctcgtgagtatgggtgcc
ctggctgccatccttgcctactggttcactcaccggccaaaggccttgcagccgccatgc
aacctcctgatgcagtcagaagaagtagaggacagtggcggggcacggcgatctgtgatt
gggtctggccctcagctacttacccactactatgatgatgcccggaccatgtaccaggtg
ttccgccgtgggcttagcatctcagggaatgggccctgtcttggtttcaggaagcctaag
cagccttaccagtggctgtcctaccaggaggtggccgacagggctgaatttctggggtcc
ggacttctccagcacaattgtaaagcatgcactgatcagtttattggtgtttttgcacaa
aatcggccagagtggatcattgtggagctggcctgctacacatattccatggtggtggtc
ccgctctatgacaccctgggccctggggctatccgctacatcatcaatacagcggacatc
agcaccgtgattgtggacaaacctcagaaggctgtgcttctgctagagcatgtggagagg
aaggagactccaggcctcaagctgatcatcctcatggacccattcgaagaagccctgaaa
gagagagggcagaagtgcggggtggtcattaagtccatgcaggccgtggaggactgtggc
caagagaatcaccaggctcctgtgcccccgcagcctgatgacctctccattgtgtgtttc
acaagcggcacgacagggaacccaaaaggtgcgatgctcacccatgggaacgtggtggct
gatttctcaggctttctgaaagtgacagagaaagtgatctttccgagacaggacgatgtg
ctcatctccttcctgcctctggctcacatgtttgagagagtaatccagtctgtcgtctat
tgccacggagggcgtgttggcttcttccagggagatatccgccttctctcagatgacatg
aaggctctatgccccaccatcttccctgtggtcccacgactgctgaaccggatgtacgac
aagatcttcagccaggcaaacacaccattaaagcgctggctcctggagtttgcagcaaag
cgtaagcaagccgaggtccggagtggaatcatcaggaatgatagtatctgggatgaactc
ttctttaataagattcaggccagtcttggtgggtgtgtgcggatgattgttactggagca
gccccagcatcaccaacagttctgggatttctccgggcagctctagggtgccaggtttat
gaaggttatggccaaactgagtgcacagctggatgtaccttcaccactcctggcgactgg
acctcagggcacgtaggggcgccacttccctgcaatcatatcaagctcgttgatgttgag
gaactgaactactgggcctgcaaaggagagggagagatatgtgtgagaggaccaaatgtg
ttcaaaggctacttgaaagatccagacaggacgaaggaggccctggacagcgatggctgg
cttcacactggagacatcggaaaatggctgccggcaggaactcttaaaattattgatcgg
aaaaagcatatatttaaacttgctcagggagaatatgttgcacccgagaagattgagaac
atctacatccggagccaacctgtggcgcaaatctatgtccatggggacagcttaaaggcc
tttttggtaggcattgttgtgcctgaccctgaagttatgccctcctgggcccagaagaga
ggaattgaaggaacatatgcagatctctgcacaaataaggatctgaagaaagccattttg
gaagatatggtgaggttaggaaaagaaagtggactccattcttttgagcaggttaaagcc
attcacatccattctgacatgttctcagttcaaaatggcttgctgacaccaacactaaaa
gctaagagacctgagctgagagagtacttcaaaaaacaaatagaagagctttactcaatc
tccatgtga

DBGET integrated database retrieval system