KEGG   Homo sapiens (human): 23305Help
Entry
23305             CDS       T01001                                 

Gene name
ACSL6, ACS2, FACL6, LACS_6, LACS2, LACS5
Definition
(RefSeq) acyl-CoA synthetase long chain family member 6
  KO
K01897  
long-chain acyl-CoA synthetase [EC:6.2.1.3]
Organism
hsa  Homo sapiens (human)
Pathway
Fatty acid biosynthesis
Fatty acid degradation
Metabolic pathways
Fatty acid metabolism
PPAR signaling pathway
Peroxisome
Ferroptosis
Adipocytokine signaling pathway
Module
beta-Oxidation, acyl-CoA synthesis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Lipid metabolism
   00061 Fatty acid biosynthesis
    23305 (ACSL6)
   00071 Fatty acid degradation
    23305 (ACSL6)
 Cellular Processes
  Transport and catabolism
   04146 Peroxisome
    23305 (ACSL6)
  Cell growth and death
   04216 Ferroptosis
    23305 (ACSL6)
 Organismal Systems
  Endocrine system
   04920 Adipocytokine signaling pathway
    23305 (ACSL6)
   03320 PPAR signaling pathway
    23305 (ACSL6)
Enzymes [BR:hsa01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.3  long-chain-fatty-acid---CoA ligase
     23305 (ACSL6)
Lipid biosynthesis proteins [BR:hsa01004]
 Acyl-CoA synthetase
  Long/very long chain acyl-CoA synthetase
   23305 (ACSL6)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   23305 (ACSL6)
  Exosomal proteins of breast cancer cells
   23305 (ACSL6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
Q9UKU0(Tbio)
UniProt: 
Position
5q31.1
AA seq 697 aa AA seqDB search
MQTQEILRILRLPELGDLGQFFRSLSATTLVSMGALAAILAYWFTHRPKALQPPCNLLMQ
SEEVEDSGGARRSVIGSGPQLLTHYYDDARTMYQVFRRGLSISGNGPCLGFRKPKQPYQW
LSYQEVADRAEFLGSGLLQHNCKACTDQFIGVFAQNRPEWIIVELACYTYSMVVVPLYDT
LGPGAIRYIINTADISTVIVDKPQKAVLLLEHVERKETPGLKLIILMDPFEEALKERGQK
CGVVIKSMQAVEDCGQENHQAPVPPQPDDLSIVCFTSGTTGNPKGAMLTHGNVVADFSGF
LKVTESQWAPTCADVHISYLPLAHMFERMVQSVVYCHGGRVGFFQGDIRLLSDDMKALCP
TIFPVVPRLLNRMYDKIFSQANTPLKRWLLEFAAKRKQAEVRSGIIRNDSIWDELFFNKI
QASLGGCVRMIVTGAAPASPTVLGFLRAALGCQVYEGYGQTECTAGCTFTTPGDWTSGHV
GAPLPCNHIKLVDVEELNYWACKGEGEICVRGPNVFKGYLKDPDRTKEALDSDGWLHTGD
IGKWLPAGTLKIIDRKKHIFKLAQGEYVAPEKIENIYIRSQPVAQIYVHGDSLKAFLVGI
VVPDPEVMPSWAQKRGIEGTYADLCTNKDLKKAILEDMVRLGKESGLHSFEQVKAIHIHS
DMFSVQNGLLTPTLKAKRPELREYFKKQIEELYSISM
NT seq 2094 nt NT seq  +upstreamnt  +downstreamnt
atgcagacacaggagatcctgaggatactgcgactgcctgagctaggtgacttgggacag
tttttccgcagcctctcggccaccaccctcgtgagtatgggtgccctggctgccatcctt
gcctactggttcactcaccggccaaaggccttgcagccgccatgcaacctcctgatgcag
tcagaagaagtagaggacagtggcggggcacggcgatctgtgattgggtctggccctcag
ctacttacccactactatgatgatgcccggaccatgtaccaggtgttccgccgtgggctt
agcatctcagggaatgggccctgtcttggtttcaggaagcctaagcagccttaccagtgg
ctgtcctaccaggaggtggccgacagggctgaatttctggggtccggacttctccagcac
aattgtaaagcatgcactgatcagtttattggtgtttttgcacaaaatcggccagagtgg
atcattgtggagctggcctgctacacatattccatggtggtggtcccgctctatgacacc
ctgggccctggggctatccgctacatcatcaatacagcggacatcagcaccgtgattgtg
gacaaacctcagaaggctgtgcttctgctagagcatgtggagaggaaggagactccaggc
ctcaagctgatcatcctcatggacccattcgaagaagccctgaaagagagagggcagaag
tgcggggtggtcattaagtccatgcaggccgtggaggactgtggccaagagaatcaccag
gctcctgtgcccccgcagcctgatgacctctccattgtgtgtttcacaagcggcacgaca
gggaacccaaaaggtgcgatgctcacccatgggaacgtggtggctgatttctcaggcttt
ctgaaagtgacagagagtcagtgggctcccacttgtgcggatgtgcacatttcctatttg
cctttagcacacatgtttgagcgaatggtgcagtctgtcgtctattgccacggagggcgt
gttggcttcttccagggagatatccgccttctctcagatgacatgaaggctctatgcccc
accatcttccctgtggtcccacgactgctgaaccggatgtacgacaagatcttcagccag
gcaaacacaccattaaagcgctggctcctggagtttgcagcaaagcgtaagcaagccgag
gtccggagtggaatcatcaggaatgatagtatctgggatgaactcttctttaataagatt
caggccagtcttggtgggtgtgtgcggatgattgttactggagcagccccagcatcacca
acagttctgggatttctccgggcagctctagggtgccaggtttatgaaggttatggccaa
actgagtgcacagctggatgtaccttcaccactcctggcgactggacctcagggcacgta
ggggcgccacttccctgcaatcatatcaagctcgttgatgttgaggaactgaactactgg
gcctgcaaaggagagggagagatatgtgtgagaggaccaaatgtgttcaaaggctacttg
aaagatccagacaggacgaaggaggccctggacagcgatggctggcttcacactggagac
atcggaaaatggctgccggcaggaactcttaaaattattgatcggaaaaagcatatattt
aaacttgctcagggagaatatgttgcacccgagaagattgagaacatctacatccggagc
caacctgtggcgcaaatctatgtccatggggacagcttaaaggcctttttggtaggcatt
gttgtgcctgaccctgaagttatgccctcctgggcccagaagagaggaattgaaggaaca
tatgcagatctctgcacaaataaggatctgaagaaagccattttggaagatatggtgagg
ttaggaaaagaaagtggactccattcttttgagcaggttaaagccattcacatccattct
gacatgttctcagttcaaaatggcttgctgacaccaacactaaaagctaagagacctgag
ctgagagagtacttcaaaaaacaaatagaagagctttactcaatctccatgtga

DBGET integrated database retrieval system