KEGG   Homo sapiens (human): 23305Help
Entry
23305             CDS       T01001                                 

Gene name
ACSL6, ACS2, FACL6, LACS_6, LACS2, LACS5
Definition
acyl-CoA synthetase long-chain family member 6 (EC:6.2.1.3)
Orthology
K01897  
long-chain acyl-CoA synthetase [EC:6.2.1.3]
Organism
hsa  Homo sapiens (human)
Pathway
Fatty acid biosynthesis
Fatty acid degradation
Metabolic pathways
Fatty acid metabolism
PPAR signaling pathway
Peroxisome
Adipocytokine signaling pathway
Module
beta-Oxidation, acyl-CoA synthesis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    23305 (ACSL6)
  Lipid metabolism
   00061 Fatty acid biosynthesis
    23305 (ACSL6)
   00071 Fatty acid degradation
    23305 (ACSL6)
 Cellular Processes
  Transport and catabolism
   04146 Peroxisome
    23305 (ACSL6)
 Organismal Systems
  Endocrine system
   04920 Adipocytokine signaling pathway
    23305 (ACSL6)
   03320 PPAR signaling pathway
    23305 (ACSL6)
Enzymes [BR:hsa01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.3  long-chain-fatty-acid---CoA ligase
     23305 (ACSL6)
Lipid biosynthesis proteins [BR:hsa01004]
 Acyl-CoA synthetase
  Long/very long chain acyl-CoA synthetase
   23305 (ACSL6)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   23305 (ACSL6)
  Exosomal proteins of breast cancer cells
   23305 (ACSL6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
5q31.1
AA seq 722 aa AA seqDB search
MLTFFLVSGGSLWLFVEFVLSLLEKMQTQEILRILRLPELGDLGQFFRSLSATTLVSMGA
LAAILAYWFTHRPKALQPPCNLLMQSEEVEDSGGARRSVIGSGPQLLTHYYDDARTMYQV
FRRGLSISGNGPCLGFRKPKQPYQWLSYQEVADRAEFLGSGLLQHNCKACTDQFIGVFAQ
NRPEWIIVELACYTYSMVVVPLYDTLGPGAIRYIINTADISTVIVDKPQKAVLLLEHVER
KETPGLKLIILMDPFEEALKERGQKCGVVIKSMQAVEDCGQENHQAPVPPQPDDLSIVCF
TSGTTGNPKGAMLTHGNVVADFSGFLKVTEKVIFPRQDDVLISFLPLAHMFERVIQSVVY
CHGGRVGFFQGDIRLLSDDMKALCPTIFPVVPRLLNRMYDKIFSQANTPLKRWLLEFAAK
RKQAEVRSGIIRNDSIWDELFFNKIQASLGGCVRMIVTGAAPASPTVLGFLRAALGCQVY
EGYGQTECTAGCTFTTPGDWTSGHVGAPLPCNHIKLVDVEELNYWACKGEGEICVRGPNV
FKGYLKDPDRTKEALDSDGWLHTGDIGKWLPAGTLKIIDRKKHIFKLAQGEYVAPEKIEN
IYIRSQPVAQIYVHGDSLKAFLVGIVVPDPEVMPSWAQKRGIEGTYADLCTNKDLKKAIL
EDMVRLGKESGLHSFEQVKAIHIHSDMFSVQNGLLTPTLKAKRPELREYFKKQIEELYSI
SM
NT seq 2169 nt NT seq  +upstreamnt  +downstreamnt
atgctgaccttcttcctcgtgtcggggggctccctctggctattcgtagagtttgtcctc
tcacttctggagaagatgcagacacaggagatcctgaggatactgcgactgcctgagcta
ggtgacttgggacagtttttccgcagcctctcggccaccaccctcgtgagtatgggtgcc
ctggctgccatccttgcctactggttcactcaccggccaaaggccttgcagccgccatgc
aacctcctgatgcagtcagaagaagtagaggacagtggcggggcacggcgatctgtgatt
gggtctggccctcagctacttacccactactatgatgatgcccggaccatgtaccaggtg
ttccgccgtgggcttagcatctcagggaatgggccctgtcttggtttcaggaagcctaag
cagccttaccagtggctgtcctaccaggaggtggccgacagggctgaatttctggggtcc
ggacttctccagcacaattgtaaagcatgcactgatcagtttattggtgtttttgcacaa
aatcggccagagtggatcattgtggagctggcctgctacacatattccatggtggtggtc
ccgctctatgacaccctgggccctggggctatccgctacatcatcaatacagcggacatc
agcaccgtgattgtggacaaacctcagaaggctgtgcttctgctagagcatgtggagagg
aaggagactccaggcctcaagctgatcatcctcatggacccattcgaagaagccctgaaa
gagagagggcagaagtgcggggtggtcattaagtccatgcaggccgtggaggactgtggc
caagagaatcaccaggctcctgtgcccccgcagcctgatgacctctccattgtgtgtttc
acaagcggcacgacagggaacccaaaaggtgcgatgctcacccatgggaacgtggtggct
gatttctcaggctttctgaaagtgacagagaaagtgatctttccgagacaggacgatgtg
ctcatctccttcctgcctctggctcacatgtttgagagagtaatccagtctgtcgtctat
tgccacggagggcgtgttggcttcttccagggagatatccgccttctctcagatgacatg
aaggctctatgccccaccatcttccctgtggtcccacgactgctgaaccggatgtacgac
aagatcttcagccaggcaaacacaccattaaagcgctggctcctggagtttgcagcaaag
cgtaagcaagccgaggtccggagtggaatcatcaggaatgatagtatctgggatgaactc
ttctttaataagattcaggccagtcttggtgggtgtgtgcggatgattgttactggagca
gccccagcatcaccaacagttctgggatttctccgggcagctctagggtgccaggtttat
gaaggttatggccaaactgagtgcacagctggatgtaccttcaccactcctggcgactgg
acctcagggcacgtaggggcgccacttccctgcaatcatatcaagctcgttgatgttgag
gaactgaactactgggcctgcaaaggagagggagagatatgtgtgagaggaccaaatgtg
ttcaaaggctacttgaaagatccagacaggacgaaggaggccctggacagcgatggctgg
cttcacactggagacatcggaaaatggctgccggcaggaactcttaaaattattgatcgg
aaaaagcatatatttaaacttgctcagggagaatatgttgcacccgagaagattgagaac
atctacatccggagccaacctgtggcgcaaatctatgtccatggggacagcttaaaggcc
tttttggtaggcattgttgtgcctgaccctgaagttatgccctcctgggcccagaagaga
ggaattgaaggaacatatgcagatctctgcacaaataaggatctgaagaaagccattttg
gaagatatggtgaggttaggaaaagaaagtggactccattcttttgagcaggttaaagcc
attcacatccattctgacatgttctcagttcaaaatggcttgctgacaccaacactaaaa
gctaagagacctgagctgagagagtacttcaaaaaacaaatagaagagctttactcaatc
tccatgtga

DBGET integrated database retrieval system