KEGG   Homo sapiens (human): 23315Help
Entry
23315             CDS       T01001                                 

Gene name
SLC9A8, NHE-8, NHE8
Definition
(RefSeq) solute carrier family 9 member A8
  KO
K14724  
solute carrier family 9 (sodium/hydrogen exchanger), member 8
Organism
hsa  Homo sapiens (human)
Brite
Transporters [BR:hsa02000]
 Solute Carrier Family (SLC)
  SLC9: Na+/H+ exchanger
   23315 (SLC9A8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
20q13.13
AA seq 581 aa AA seqDB search
MGEKMAEEERFPNTTHEGFNVTLHTTLVVTTKLVLPTPGKPILPVQTGEQAQQEEQSSGM
TIFFSLLVLAICIILVHLLIRYRLHFLPESVAVVSLGILMGAVIKIIEFKKLANWKEEEM
FRPNMFFLLLLPPIIFESGYSLHKGNFFQNIGSITLFAVFGTAISAFVVGGGIYFLGQAD
VISKLNMTDSFAFGSLISAVDPVATIAIFNALHVDPVLNMLVFGESILNDAVSIVLTNTA
EGLTRKNMSDVSGWQTFLQALDYFLKMFFGSAALGTLTGLISALVLKHIDLRKTPSLEFG
MMIIFAYLPYGLAEGISLSGIMAILFSGIVMSHYTHHNLSPVTQILMQQTLRTVAFLCET
CVFAFLGLSIFSFPHKFEISFVIWCIVLVLFGRAVNIFPLSYLLNFFRDHKITPKMMFIM
WFSGLRGAIPYALSLHLDLEPMEKRQLIGTTTIVIVLFTILLLGGSTMPLIRLMDIEDAK
AHRRNKKDVNLSKTEKMGNTVESEHLSELTEEEYEAHYIRRQDLKGFVWLDAKYLNPFFT
RRLTQEDLHHGRIQMKTLTNKWYEEVRQGPSGSEDDEQELL
NT seq 1746 nt NT seq  +upstreamnt  +downstreamnt
atgggggagaagatggcggaagaggagaggttccccaatacaactcatgagggtttcaat
gtcaccctccacaccaccctggttgtcacgacgaaactggtgctcccgacccctggcaag
cccatcctccccgtgcagacaggggagcaggcccagcaagaggagcagtccagcggcatg
accattttcttcagcctccttgtcctagctatctgcatcatattggtgcatttactgatc
cgatacagattacatttcttgccagagagtgttgctgttgtttctttaggtattctcatg
ggagcagttataaaaattatagagtttaaaaaactggcgaattggaaggaagaagaaatg
tttcgtccaaacatgtttttcctcctcctgcttccccctattatctttgagtctggatat
tcattacacaagggtaacttctttcaaaatattggttccatcaccctgtttgctgttttt
gggacggcaatctccgcttttgtagtaggtggaggaatttattttctgggtcaggctgat
gtaatctctaaactcaacatgacagacagttttgcgtttggctccctaatatctgctgtc
gatccagtggccactattgccattttcaatgcacttcatgtggaccccgtgctcaacatg
ctggtctttggagaaagtattctcaacgatgcagtctccattgttctgaccaacacagct
gaaggtttaacaagaaaaaatatgtcagatgtcagtgggtggcaaacatttttacaagcc
cttgactacttcctcaaaatgttctttggctctgcagcgctcggcactctcactggctta
atttctgcattagtgctgaagcatattgacttgaggaaaacgccttccttggagtttggc
atgatgatcatttttgcttatctgccttatgggcttgcagaaggaatctcactctcaggc
atcatggccatccttttctcaggcatcgtgatgtcccactacacgcaccataacctctcc
ccagtcacccagatcctcatgcagcagaccctccgcaccgtggccttcttatgtgaaaca
tgtgtgtttgcatttcttggcctgtccatttttagttttcctcacaagtttgaaatttcc
tttgtcatctggtgcatagtgcttgtactatttggcagagcggtaaacattttccctctt
tcctacctcctgaatttcttccgggatcataaaatcacaccgaagatgatgttcatcatg
tggtttagtggcctgcggggagccatcccctatgccctgagcctacacctggacctggag
cccatggagaagcggcagctcatcggcaccaccaccatcgtcatcgtgctcttcaccatc
ctgctgctgggcggcagcaccatgcccctcattcgcctcatggacatcgaggacgccaag
gcacaccgcaggaacaagaaggacgtcaacctcagcaagactgagaagatgggcaacact
gtggagtcggagcacctgtcggagctcacggaggaggagtacgaggcccactacatcagg
cggcaggaccttaagggcttcgtgtggctggacgccaagtacctgaaccccttcttcact
cggaggctgacgcaggaggacctgcaccacgggcgcatccagatgaaaactctcaccaac
aagtggtacgaggaggtacgccagggcccctccggctccgaggacgacgagcaggagctg
ctctga

DBGET integrated database retrieval system