KEGG   Homo sapiens (human): 23326Help
Entry
23326             CDS       T01001                                 

Gene name
USP22, USP3L
Definition
ubiquitin specific peptidase 22 (EC:3.4.19.12)
Orthology
K11366  
ubiquitin carboxyl-terminal hydrolase 22/27/51 [EC:3.1.2.15]
Organism
hsa  Homo sapiens (human)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
UniProt: 
Position
17p11.2
AA seq 525 aa AA seqDB search
MVSRPEPEGEAMDAELAVAPPGCSHLGSFKVDNWKQNLRAIYQCFVWSGTAEARKRKAKS
CICHVCGVHLNRLHSCLYCVFFGCFTKKHIHEHAKAKRHNLAIDLMYGGIYCFLCQDYIY
DKDMEIIAKEEQRKAWKMQGVGEKFSTWEPTKRELELLKHNPKRRKITSNCTIGLRGLIN
LGNTCFMNCIVQALTHTPLLRDFFLSDRHRCEMQSPSSCLVCEMSSLFQEFYSGHRSPHI
PYKLLHLVWTHARHLAGYEQQDAHEFLIAALDVLHRHCKGDDNGKKANNPNHCNCIIDQI
FTGGLQSDVTCQVCHGVSTTIDPFWDISLDLPGSSTPFWPLSPGSEGNVVNGESHVSGTT
TLTDCLRRFTRPEHLGSSAKIKCSGCHSYQESTKQLTMKKLPIVACFHLKRFEHSAKLRR
KITTYVSFPLELDMTPFMASSKESRMNGQYQQPTDSLNNDNKYSLFAVVNHQGTLESGHY
TSFIRQHKDQWFKCDDAIITKASIKDVLDSEGYLLFYHKQFLEYE
NT seq 1578 nt NT seq  +upstreamnt  +downstreamnt
atggtgtcccggccagagcccgagggcgaggccatggacgccgagctggcggtagcgccg
ccgggctgctcgcacctgggcagcttcaaggtggacaactggaagcagaacctgcgggcc
atctaccagtgcttcgtgtggagcggcacggctgaggcccgcaagcgcaaggccaagtcc
tgtatctgccatgtctgtggcgtccacctcaacaggctgcattcctgcctctactgtgtc
ttcttcggctgtttcacaaagaagcatattcacgagcatgcgaaggcgaagcggcacaac
ctggccattgatctgatgtacggaggcatctactgttttctgtgccaggactacatctat
gacaaagacatggaaataatcgccaaggaggagcagcgaaaagcttggaaaatgcaaggc
gttggagagaagttttcaacttgggaaccaaccaaacgggagcttgaactgctgaagcac
aacccgaaaaggagaaagatcacctcgaactgcaccataggtctgcgtgggctgatcaac
cttgggaacacatgcttcatgaactgcatcgtgcaggccctgacccacacgccacttctg
cgggacttcttcctgtctgacaggcaccgctgtgagatgcagagccccagctcctgtctg
gtctgtgagatgtcctcactgtttcaggagttttactctggacaccggtcccctcacatc
ccgtataagttgctgcacctggtgtggacccacgcgaggcacctagcaggctacgagcag
caggacgcccacgagttcctcatcgcggccctggacgtgctccaccgacactgcaaaggt
gatgacaatgggaagaaggccaacaaccccaaccactgcaactgcatcatagaccagatc
ttcacaggcgggttgcagtcagacgtcacctgccaagtctgccatggagtctccaccacc
atcgaccccttctgggacatcagcttggatctccccggctcttccaccccattctggccc
ctgagcccagggagcgagggcaacgtggtaaacggggaaagccacgtgtcgggaaccacc
acgctcacggactgcctgcgacgattcaccagaccagagcacttgggcagcagcgccaag
atcaagtgcagcggttgccatagctaccaggagtccacaaagcagctcactatgaagaaa
ctgcccatcgtagcctgttttcatctcaaacgatttgaacactcagccaagctgcggcgg
aagatcaccacgtatgtgtccttccccctggagctggacatgacccctttcatggcctcc
agcaaagagagcaggatgaatggacagtaccagcagcccacggacagtctcaacaatgac
aacaagtattccctgtttgctgttgttaaccatcaagggaccttggagagtggccactac
accagctttatccggcagcacaaagaccagtggttcaagtgtgacgatgccatcatcacc
aaggccagcatcaaggacgtcctggacagcgaagggtacttgctgttctatcacaaacag
ttcctggaatacgagtag

DBGET integrated database retrieval system