KEGG   Homo sapiens (human): 23327Help
Entry
23327             CDS       T01001                                 

Gene name
NEDD4L, NEDD4-2, NEDD4.2, RSP5, hNEDD4-2
Definition
(RefSeq) neural precursor cell expressed, developmentally down-regulated 4-like, E3 ubiquitin protein ligase (EC:6.3.2.-)
  KO
K13305  
E3 ubiquitin-protein ligase NEDD4-like [EC:2.3.2.26]
Organism
hsa  Homo sapiens (human)
Pathway
Ubiquitin mediated proteolysis
Endocytosis
Aldosterone-regulated sodium reabsorption
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    23327 (NEDD4L)
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    23327 (NEDD4L)
 Organismal Systems
  Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    23327 (NEDD4L)
Enzymes [BR:hsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.26  HECT-type E3 ubiquitin transferase
     23327 (NEDD4L)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  HECT type E3
   23327 (NEDD4L)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
18q21.31
AA seq 975 aa AA seqDB search
MATGLGEPVYGLSEDEGESRILRVKVVSGIDLAKKDIFGASDPYVKLSLYVADENRELAL
VQTKTIKKTLNPKWNEEFYFRVNPSNHRLLFEVFDENRLTRDDFLGQVDVPLSHLPTEDP
TMERPYTFKDFLLRPRSHKSRVKGFLRLKMAYMPKNGGQDEENSDQRDDMEHGWEVVDSN
DSASQHQEELPPPPLPPGWEEKVDNLGRTYYVNHNNRTTQWHRPSLMDVSSESDNNIRQI
NQEAAHRRFRSRRHISEDLEPEPSEGGDVPEPWETISEEVNIAGDSLGLALPPPPASPGS
RTSPQELSEELSRRLQITPDSNGEQFSSLIQREPSSRLRSCSVTDAVAEQGHLPPPSAPA
GRARSSTVTGGEEPTPSVAYVHTTPGLPSGWEERKDAKGRTYYVNHNNRTTTWTRPIMQL
AEDGASGSATNSNNHLIEPQIRRPRSLSSPTVTLSAPLEGAKDSPVRRAVKDTLSNPQSP
QPSPYNSPKPQHKVTQSFLPPGWEMRIAPNGRPFFIDHNTKTTTWEDPRLKFPVHMRSKT
SLNPNDLGPLPPGWEERIHLDGRTFYIDHNSKITQWEDPRLQNPAITGPAVPYSREFKQK
YDYFRKKLKKPADIPNRFEMKLHRNNIFEESYRRIMSVKRPDVLKARLWIEFESEKGLDY
GGVAREWFFLLSKEMFNPYYGLFEYSATDNYTLQINPNSGLCNEDHLSYFTFIGRVAGLA
VFHGKLLDGFFIRPFYKMMLGKQITLNDMESVDSEYYNSLKWILENDPTELDLMFCIDEE
NFGQTYQVDLKPNGSEIMVTNENKREYIDLVIQWRFVNRVQKQMNAFLEGFTELLPIDLI
KIFDENELELLMCGLGDVDVNDWRQHSIYKNGYCPNHPVIQWFWKAVLLMDAEKRIRLLQ
FVTGTSRVPMNGFAELYGSNGPQLFTIEQWGSPEKLPRAHTCFNRLDLPPYETFEDLREK
LLMAVENAQGFEGVD
NT seq 2928 nt NT seq  +upstreamnt  +downstreamnt
atggcgaccgggctcggggagccggtctatggactttccgaagacgagggagagtcccgt
attctcagagtaaaagttgtttctggaattgatctcgccaaaaaggacatctttggagcc
agtgatccgtatgtgaaactttcattgtacgtagcggatgagaatagagaacttgctttg
gtccagacaaaaacaattaaaaagacactgaacccaaaatggaatgaagaattttatttc
agggtaaacccatctaatcacagactcctatttgaagtatttgacgaaaatagactgaca
cgagacgacttcctgggccaggtggacgtgccccttagtcaccttccgacagaagatcca
accatggagcgaccctatacatttaaggactttctcctcagaccaagaagtcataagtct
cgagttaagggatttttgcgattgaaaatggcctatatgccaaaaaatggaggtcaagat
gaagaaaacagtgaccagagggatgacatggagcatggatgggaagttgttgactcaaat
gactcggcttctcagcaccaagaggaacttcctcctcctcctctgcctcccgggtgggaa
gaaaaagtggacaatttaggccgaacttactatgtcaaccacaacaaccggaccactcag
tggcacagaccaagcctgatggacgtgtcctcggagtcggacaataacatcagacagatc
aaccaggaggcagcacaccggcgcttccgctcccgcaggcacatcagcgaagacttggag
cccgagccctcggagggcggggatgtccccgagccttgggagaccatttcagaggaagtg
aatatcgctggagactctctcggtctggctctgcccccaccaccggcctccccaggatct
cggaccagccctcaggagctgtcagaggaactaagcagaaggcttcagatcactccagac
tccaatggggaacagttcagctctttgattcaaagagaaccctcctcaaggttgaggtca
tgcagtgtcaccgacgcagttgcagaacagggccatctaccaccgcccagtgccccagct
gggagagcgcgttcatcaactgtcacgggtggtgaggaaccaacgccatcagtggcctat
gtacataccacgccgggtctgccttcaggctgggaagaaagaaaagatgctaaggggcgc
acatactatgtcaatcataacaatcgaaccacaacttggactcgacctatcatgcagctt
gcagaagatggtgcgtccggatcagccacaaacagtaacaaccatctaatcgagcctcag
atccgccggcctcgtagcctcagctcgccaacagtaactttatctgccccgctggagggt
gccaaggactcacccgtacgtcgggctgtgaaagacaccctttccaacccacagtcccca
cagccatcaccttacaactcccccaaaccacaacacaaagtcacacagagcttcttgcca
cccggctgggaaatgaggatagcgccaaacggccggcccttcttcattgatcataacaca
aagactacaacctgggaagatccacgtttgaaatttccagtacatatgcggtcaaagaca
tctttaaaccccaatgaccttggcccccttcctcctggctgggaagaaagaattcacttg
gatggccgaacgttttatattgatcataatagcaaaattactcagtgggaagacccaaga
ctgcagaacccagctattactggtccggctgtcccttactccagagaatttaagcagaaa
tatgactacttcaggaagaaattaaagaaacctgctgatatccccaataggtttgaaatg
aaacttcacagaaataacatatttgaagagtcctatcggagaattatgtccgtgaaaaga
ccagatgtcctaaaagctagactgtggattgagtttgaatcagagaaaggtcttgactat
gggggtgtggccagagaatggttcttcttactgtccaaagagatgttcaacccctactac
ggcctctttgagtactctgccacggacaactacacccttcagatcaaccctaattcaggc
ctctgtaatgaggatcatttgtcctacttcacttttattggaagagttgctggtctggcc
gtatttcatgggaagctcttagatggtttcttcattagaccattttacaagatgatgttg
ggaaagcagataaccctgaatgacatggaatctgtggatagtgaatattacaactctttg
aaatggatcctggagaatgaccctactgagctggacctcatgttctgcatagacgaagaa
aactttggacagacatatcaagtggatttgaagcccaatgggtcagaaataatggtcaca
aatgaaaacaaaagggaatatatcgacttagtcatccagtggagatttgtgaacagggtc
cagaagcagatgaacgccttcttggagggattcacagaactacttcctattgatttgatt
aaaatttttgatgaaaatgagctggagttgctcatgtgcggcctcggtgatgtggatgtg
aatgactggagacagcattctatttacaagaacggctactgcccaaaccaccccgtcatt
cagtggttctggaaggctgtgctactcatggacgccgaaaagcgtatccggttactgcag
tttgtcacagggacatcgcgagtacctatgaatggatttgccgaactttatggttccaat
ggtcctcagctgtttacaatagagcaatggggcagtcctgagaaactgcccagagctcac
acatgctttaatcgccttgacttacctccatatgaaacctttgaagatttacgagagaaa
cttctcatggccgtggaaaatgctcaaggatttgaaggggtggattaa

DBGET integrated database retrieval system