KEGG   Homo sapiens (human): 23327Help
Entry
23327             CDS       T01001                                 

Gene name
NEDD4L, NEDD4-2, NEDD4.2, RSP5, hNEDD4-2
Definition
neural precursor cell expressed, developmentally down-regulated 4-like, E3 ubiquitin protein ligase (EC:6.3.2.-)
Orthology
K13305  
E3 ubiquitin-protein ligase NEDD4-like [EC:6.3.2.19]
Organism
hsa  Homo sapiens (human)
Pathway
Ubiquitin mediated proteolysis
Endocytosis
Aldosterone-regulated sodium reabsorption
Class
Genetic Information Processing; Folding, sorting and degradation; Ubiquitin mediated proteolysis [PATH:hsa04120]
Cellular Processes; Transport and catabolism; Endocytosis [PATH:hsa04144]
Organismal Systems; Excretory system; Aldosterone-regulated sodium reabsorption [PATH:hsa04960]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
18q21
AA seq 854 aa AA seqDB search
MERPYTFKDFLLRPRSHKSRVKGFLRLKMAYMPKNGGQDEENSDQRDDMEHGWEVVDSND
SASQHQEELPPPPLPPGWEEKVDNLGRTYYVNHNNRTTQWHRPSLMDVSSESDNNIRQIN
QEAAHRRFRSRRHISEDLEPEPSEGGDVPEPWETISEEVNIAGDSLGLALPPPPASPGSR
TSPQELSEELSRRLQITPDSNGEQFSSLIQREPSSRLRSCSVTDAVAEQGHLPPPSAPAG
RARSSTVTGGEEPTPSVAYVHTTPGLPSGWEERKDAKGRTYYVNHNNRTTTWTRPIMQLA
EDGASGSATNSNNHLIEPQIRRPRSLSSPTVTLSAPLEGAKDSPVRRAVKDTLSNPQSPQ
PSPYNSPKPQHKVTQSFLPPGWEMRIAPNGRPFFIDHNTKTTTWEDPRLKFPVHMRSKTS
LNPNDLGPLPPGWEERIHLDGRTFYIDHNSKITQWEDPRLQNPAITGPAVPYSREFKQKY
DYFRKKLKKPADIPNRFEMKLHRNNIFEESYRRIMSVKRPDVLKARLWIEFESEKGLDYG
GVAREWFFLLSKEMFNPYYGLFEYSATDNYTLQINPNSGLCNEDHLSYFTFIGRVAGLAV
FHGKLLDGFFIRPFYKMMLGKQITLNDMESVDSEYYNSLKWILENDPTELDLMFCIDEEN
FGQTYQVDLKPNGSEIMVTNENKREYIDLVIQWRFVNRVQKQMNAFLEGFTELLPIDLIK
IFDENELELLMCGLGDVDVNDWRQHSIYKNGYCPNHPVIQWFWKAVLLMDAEKRIRLLQF
VTGTSRVPMNGFAELYGSNGPQLFTIEQWGSPEKLPRAHTCFNRLDLPPYETFEDLREKL
LMAVENAQGFEGVD
NT seq 2565 nt NT seq  +upstreamnt  +downstreamnt
atggagcgaccctatacatttaaggactttctcctcagaccaagaagtcataagtctcga
gttaagggatttttgcgattgaaaatggcctatatgccaaaaaatggaggtcaagatgaa
gaaaacagtgaccagagggatgacatggagcatggatgggaagttgttgactcaaatgac
tcggcttctcagcaccaagaggaacttcctcctcctcctctgcctcccgggtgggaagaa
aaagtggacaatttaggccgaacttactatgtcaaccacaacaaccggaccactcagtgg
cacagaccaagcctgatggacgtgtcctcggagtcggacaataacatcagacagatcaac
caggaggcagcacaccggcgcttccgctcccgcaggcacatcagcgaagacttggagccc
gagccctcggagggcggggatgtccccgagccttgggagaccatttcagaggaagtgaat
atcgctggagactctctcggtctggctctgcccccaccaccggcctccccaggatctcgg
accagccctcaggagctgtcagaggaactaagcagaaggcttcagatcactccagactcc
aatggggaacagttcagctctttgattcaaagagaaccctcctcaaggttgaggtcatgc
agtgtcaccgacgcagttgcagaacagggccatctaccaccgcccagtgccccagctggg
agagcgcgttcatcaactgtcacgggtggtgaggaaccaacgccatcagtggcctatgta
cataccacgccgggtctgccttcaggctgggaagaaagaaaagatgctaaggggcgcaca
tactatgtcaatcataacaatcgaaccacaacttggactcgacctatcatgcagcttgca
gaagatggtgcgtccggatcagccacaaacagtaacaaccatctaatcgagcctcagatc
cgccggcctcgtagcctcagctcgccaacagtaactttatctgccccgctggagggtgcc
aaggactcacccgtacgtcgggctgtgaaagacaccctttccaacccacagtccccacag
ccatcaccttacaactcccccaaaccacaacacaaagtcacacagagcttcttgccaccc
ggctgggaaatgaggatagcgccaaacggccggcccttcttcattgatcataacacaaag
actacaacctgggaagatccacgtttgaaatttccagtacatatgcggtcaaagacatct
ttaaaccccaatgaccttggcccccttcctcctggctgggaagaaagaattcacttggat
ggccgaacgttttatattgatcataatagcaaaattactcagtgggaagacccaagactg
cagaacccagctattactggtccggctgtcccttactccagagaatttaagcagaaatat
gactacttcaggaagaaattaaagaaacctgctgatatccccaataggtttgaaatgaaa
cttcacagaaataacatatttgaagagtcctatcggagaattatgtccgtgaaaagacca
gatgtcctaaaagctagactgtggattgagtttgaatcagagaaaggtcttgactatggg
ggtgtggccagagaatggttcttcttactgtccaaagagatgttcaacccctactacggc
ctctttgagtactctgccacggacaactacacccttcagatcaaccctaattcaggcctc
tgtaatgaggatcatttgtcctacttcacttttattggaagagttgctggtctggccgta
tttcatgggaagctcttagatggtttcttcattagaccattttacaagatgatgttggga
aagcagataaccctgaatgacatggaatctgtggatagtgaatattacaactctttgaaa
tggatcctggagaatgaccctactgagctggacctcatgttctgcatagacgaagaaaac
tttggacagacatatcaagtggatttgaagcccaatgggtcagaaataatggtcacaaat
gaaaacaaaagggaatatatcgacttagtcatccagtggagatttgtgaacagggtccag
aagcagatgaacgccttcttggagggattcacagaactacttcctattgatttgattaaa
atttttgatgaaaatgagctggagttgctcatgtgcggcctcggtgatgtggatgtgaat
gactggagacagcattctatttacaagaacggctactgcccaaaccaccccgtcattcag
tggttctggaaggctgtgctactcatggacgccgaaaagcgtatccggttactgcagttt
gtcacagggacatcgcgagtacctatgaatggatttgccgaactttatggttccaatggt
cctcagctgtttacaatagagcaatggggcagtcctgagaaactgcccagagctcacaca
tgctttaatcgccttgacttacctccatatgaaacctttgaagatttacgagagaaactt
ctcatggccgtggaaaatgctcaaggatttgaaggggtggattaa

DBGET integrated database retrieval system