KEGG   Homo sapiens (human): 2334Help
Entry
2334              CDS       T01001                                 

Gene name
AFF2, FMR2, FMR2P, FRAXE, MRX2, OX19
Definition
(RefSeq) AF4/FMR2 family member 2
  KO
K15194  
AF4/FMR2 family member 2
Organism
hsa  Homo sapiens (human)
Disease
H00480  
Non-syndromic X-linked mental retardation
H00627  
Premature ovarian failure
Brite
Transcription machinery [BR:hsa03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Others
     2334 (AFF2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
Xq28
AA seq 1311 aa AA seqDB search
MDLFDFFRDWDLEQQCHYEQDRSALKKREWERRNQEVQQEDDLFSSGFDLFGEPYKVAEY
TNKGDALANRVQNTLGNYDEMKNLLTNHSNQNHLVGIPKNSVPQNPNNKNEPSFFPEQKN
RIIPPHQDNTHPSAPMPPPSVVILNSTLIHSNRKSKPEWSRDSHNPSTVLASQASGQPNK
MQTLTQDQSQAKLEDFFVYPAEQPQIGEVEESNPSAKEDSNPNSSGEDAFKEIFQSNSPE
ESEFAVQAPGSPLVASSLLAPSSGLSVQNFPPGLYCKTSMGQQKPTAYVRPMDGQDQAPD
ISPTLKPSIEFENSFGNLSFGTLLDGKPSAASSKTKLPKFTILQTSEVSLPSDPSCVEEI
LREMTHSWPTPLTSMHTAGHSEQSTFSIPGQESQHLTPGFTLQKWNDPTTRASTKSVSFK
SMLEDDLKLSSDEDDLEPVKTLTTQCTATELYQAVEKAKPRNNPVNPPLATPQPPPAVQA
SGGSGSSSESESSSESDSDTESSTTDSESNEAPRVATPEPEPPSTNKWQLDKWLNKVTSQ
NKSFICGQNETPMETISLPPPIIQPMEVQMKVKTNASQVPAEPKERPLLSLIREKARPRP
TQKIPETKALKHKLSTTSETVSQRTIGKKQPKKVEKNTSTDEFTWPKPNITSSTPKEKES
VELHDPPRGRNKATAHKPAPRKEPRPNIPLAPEKKKYRGPGKIVPKSREFIETDSSTSDS
NTDQEETLQIKVLPPCIISGGNTAKSKEICGASLTLSTLMSSSGSNNNLSISNEEPTFSP
IPVMQTEILSPLRDHENLKNLWVKIDLDLLSRVPGHSSLHAAPAKPDHKETATKPKRQTA
VTAVEKPAPKGKRKHKPIEVAEKIPEKKQRLEEATTICLLPPCISPAPPHKPPNTRENNS
SRRANRRKEEKLFPPPLSPLPEDPPRRRNVSGNNGPFGQDKNIAMTGQITSTKPKRTEGK
FCATFKGISVNEGDTPKKASSATITVTNTAIATATVTATAIVTTTVTATATATATTTTTT
TTISTITSTITTGLMDSSHLEMTSWAALPLLSSSSTNVRRPKLTFDDSVHNADYYMQEAK
KLKHKADALFEKFGKAVNYADAALSFTECGNAMERDPLEAKSPYTMYSETVELLRYAMRL
KNFASPLASDGDKKLAVLCYRCLSLLYLRMFKLKKDHAMKYSRSLMEYFKQNASKVAQIP
SPWVSNGKNTPSPVSLNNVSPINAMGNCNNGPVTIPQRIHHMAASHVNITSNVLRGYEHW
DMADKLTRENKEFFGDLDTLMGPLTQHSSMTNLVRYVRQGLCWLRIDAHLL
NT seq 3936 nt NT seq  +upstreamnt  +downstreamnt
atggatctattcgactttttcagagactgggacttggagcagcagtgtcactatgaacaa
gaccgtagtgcacttaaaaaaagggaatgggagcggaggaatcaagaagtccagcaagaa
gacgatctcttttcttcaggctttgatctttttggggagccatacaaggtagctgaatat
acaaacaaaggtgatgcacttgccaaccgagtccagaacacgcttggaaactatgatgaa
atgaagaatttgctaactaaccattctaatcagaatcacctagtgggaattccaaagaat
tctgtgccccagaatcccaacaacaaaaatgaaccaagcttttttccagaacaaaagaac
agaataattccacctcaccaggataatacccatccttcagcaccaatgcctccaccttct
gttgtgatactgaattcaactctaatacacagcaacagaaaatcaaaacctgagtggtca
cgtgatagtcataaccctagcactgtactggcaagccaggccagtggtcagccaaacaag
atgcagactttgacacaggaccagtctcaagccaaactggaagacttctttgtctaccca
gctgaacagccccagattggagaagttgaagagtcaaacccatctgcaaaggaagacagt
aaccctaattctagtggagaagatgctttcaaagaaatctttcaatccaattcaccggaa
gaatctgaattcgccgtgcaagcgcctgggtctcccctagtggcttcctctttattagct
cctagcagtggcctttcagttcaaaacttcccaccagggctttactgcaaaacaagcatg
gggcagcaaaagccaactgcatacgtcagacccatggatggccaggaccaggcaccggac
atctcaccaacactgaaaccttcaattgaatttgagaacagctttgggaatctgtcattt
ggaacactcttggatggaaaacccagtgcagccagttcaaagactaaactgccaaagttc
accatcctccaaacaagtgaagtaagccttcccagtgatccaagctgtgttgaagaaatc
ttgcgggagatgacccattcctggcctactcctctcacttccatgcatactgctggacac
tctgagcagagcaccttttccatcccaggacaggaatcgcagcatctgaccccaggattc
accttacaaaagtggaatgacccaaccaccagagcttctacaaagtcagtgtctttcaaa
tcgatgcttgaggatgacctgaagctgagcagtgatgaagatgaccttgagcctgtgaag
accttgaccactcagtgcactgccactgagctctaccaggctgttgaaaaggcaaaacct
aggaataatcctgtgaacccacccttggccactccccagcccccacctgcagtgcaagcc
agcgggggttctggcagctccagcgaatcggagagcagctctgagtcggattcagacact
gaaagtagcaccactgacagcgaatctaatgaggcacctcgtgtggcaactccagagcct
gagccaccctcaaccaacaagtggcaactggataaatggcttaacaaagtgacatcccag
aacaagtcttttatttgtggccaaaatgaaacacccatggagactatttctctgcctcct
ccaatcatccaaccaatggaagtccagatgaaagtgaagacgaatgccagtcaggtccca
gctgaacccaaagaaaggcctctcctcagtctcattagggagaaagcccgtccacggccc
actcagaaaattccagaaacaaaggctttgaagcataagttgtcaacaactagtgagaca
gtgtctcaaaggacaattgggaaaaaacagcccaaaaaagttgagaagaacaccagcact
gacgagtttacctggcccaaaccaaatattaccagcagcactcccaaagaaaaagaaagt
gtggagcttcatgacccaccaagaggccgcaacaaagccactgcccacaaaccagcccct
aggaaagaaccaagacctaacatccctttggctcccgagaagaagaagtacagagggcct
ggcaagattgtgccaaagtctcgggaattcattgaaacagattcatctacatctgactcc
aacacagatcaggaagagaccctgcaaatcaaagtcctgcctccgtgcattatttctgga
ggtaatactgccaaatccaaggaaatctgtggtgccagcctgaccctcagcaccttaatg
agtagcagtggcagcaacaacaacttatccatcagtaatgaagagccaacattttcacct
attcctgtcatgcaaactgaaatcctgtcccctctgcgagatcatgagaacctgaaaaac
ctctgggtgaagattgaccttgacttactctctagagtacctggccacagctcactccat
gcagcacctgccaagccagaccacaaggagactgccacaaaacccaagcgtcagacagct
gtcacagctgtggagaaaccagcccctaagggcaaacgtaagcacaagccaatagaagtt
gcagagaagatccctgagaagaagcagcgcctggaggaggccacaactatctgcttgctc
cctccttgcatctcaccagccccaccccacaagcctcccaacactagagaaaataattca
tccaggagagcaaatagaagaaaggaagaaaaactatttcctcctccactttccccactg
ccagaggaccctccacgccgcagaaatgtcagtggcaataatggtccctttggtcaagac
aaaaacatcgccatgactggacaaatcacatctaccaaacctaagagaactgaaggcaaa
ttctgtgctactttcaaagggatatcggtaaatgagggagacactccaaaaaaggcatcc
tctgccaccatcactgtcaccaatactgctattgccactgctactgtcactgctactgcc
attgtcaccaccactgtcacagctactgccaccgccacggccaccaccacaactactacc
actaccatttccaccatcacctctaccatcactactggcctcatggatagcagtcacctg
gagatgacgtcctgggcggctctgccccttctatccagcagcagcactaatgtccggaga
cccaagctcacttttgatgactcggttcacaatgctgattattacatgcaagaagctaag
aagctgaagcacaaagctgatgcactgttcgagaaatttggcaaagctgtgaattatgct
gatgccgccctctccttcactgaatgtggcaatgccatggaacgcgaccctctggaagca
aagtccccatacaccatgtactctgagactgtggagctcctcaggtatgcaatgaggctg
aagaactttgcaagtcccttggcttcggatggggacaaaaagctagcagtactatgctac
cgatgtttatcactcctctatttgagaatgtttaagctgaagaaggaccatgctatgaag
tactccagatcactgatggaatattttaagcaaaatgcttcaaaagtcgcacagataccc
tctccatgggtaagcaatggaaagaacactccatccccagtgtctctcaacaacgtctcc
cccatcaacgcaatggggaactgtaacaatggcccagtcaccattccccagcgcattcac
cacatggctgccagccacgtcaacatcactagcaatgtgttacggggctatgaacactgg
gatatggccgacaaactgacaagagaaaacaaagaattctttggtgatctggacacgctg
atggggcctctgacccagcacagcagcatgaccaatcttgtccgctacgttcgccaagga
ctgtgttggctgcgcatcgatgcccacttgttgtag

DBGET integrated database retrieval system