KEGG   Homo sapiens (human): 23350Help
Entry
23350             CDS       T01001                                 

Gene name
U2SURP, SR140, fSAPa
Definition
(RefSeq) U2 snRNP associated SURP domain containing
  KO
K12842  
U2-associated protein SR140
Organism
hsa  Homo sapiens (human)
Pathway
Spliceosome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Transcription
   03040 Spliceosome
    23350 (U2SURP)
Spliceosome [BR:hsa03041]
 Complex A
  U2 snRNP components
   U2 related factors
    23350 (U2SURP)
 Complex B
    23350 (U2SURP)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
O15042(Tdark)
UniProt: 
Position
3q23
AA seq 1029 aa AA seqDB search
MADKTPGGSQKASSKTRSSDVHSSGSSDAHMDASGPSDSDMPSRTRPKSPRKHNYRNESA
RESLCDSPHQNLSRPLLENKLKAFSIGKMSTAKRTLSKKEQEELKKKEDEKAAAEIYEEF
LAAFEGSDGNKVKTFVRGGVVNAAKEEHETDEKRGKIYKPSSRFADQKNPPNQSSNERPP
SLLVIETKKPPLKKGEKEKKKSNLELFKEELKQIQEERDERHKTKGRLSRFEPPQSDSDG
QRRSMDAPSRRNRSSGVLDDYAPGSHDVGDPSTTNLYLGNINPQMNEEMLCQEFGRFGPL
ASVKIMWPRTDEERARERNCGFVAFMNRRDAERALKNLNGKMIMSFEMKLGWGKAVPIPP
HPIYIPPSMMEHTLPPPPSGLPFNAQPRERLKNPNAPMLPPPKNKEDFEKTLSQAIVKVV
IPTERNLLALIHRMIEFVVREGPMFEAMIMNREINNPMFRFLFENQTPAHVYYRWKLYSI
LQGDSPTKWRTEDFRMFKNGSFWRPPPLNPYLHGMSEEQETEAFVEEPSKKGALKEEQRD
KLEEILRGLTPRKNDIGDAMVFCLNNAEAAEEIVDCITESLSILKTPLPKKIARLYLVSD
VLYNSSAKVANASYYRKFFETKLCQIFSDLNATYRTIQGHLQSENFKQRVMTCFRAWEDW
AIYPEPFLIKLQNIFLGLVNIIEEKETEDVPDDLDGAPIEEELDGAPLEDVDGIPIDATP
IDDLDGVPIKSLDDDLDGVPLDATEDSKKNEPIFKVAPSKWEAVDESELEAQAVTTSKWE
LFDQHEESEEEENQNQEEESEDEEDTQSSKSEEHHLYSNPIKEEMTESKFSKYSEMSEEK
RAKLREIELKVMKFQDELESGKRPKKPGQSFQEQVEHYRDKLLQREKEKELERERERDKK
DKEKLESRSKDKKEKDECTPTRKERKRRHSTSPSPSRSSSGRRVKSPSPKSERSERSERS
HKESSRSRSSHKDSPRDVSKKAKRSPSGSRTPKRSRRSRSRSPKKSGKKSRSQSRSPHRS
HKKSKKNKH
NT seq 3090 nt NT seq  +upstreamnt  +downstreamnt
atggcggacaaaacgccaggcggatctcagaaggccagttcaaagacgagatcatcagat
gttcattcatctggatcttcagatgcacatatggatgcatctggaccctcagatagtgat
atgccaagtcggacacgacctaagagcccaagaaaacataattataggaatgaaagtgcc
cgtgaaagcctttgtgattctcctcatcagaatctctcaagacctcttctggaaaacaaa
cttaaagcattcagtattggaaaaatgagtacagctaagcgaactttaagtaaaaaggaa
caggaagaattaaagaaaaaggaggatgaaaaggcagctgctgagatttatgaggagttt
cttgctgcttttgaaggaagtgatggtaataaagtgaaaacatttgtgcgagggggtgtt
gttaatgcagctaaagaagaacatgaaacagatgaaaaaagaggtaaaatctataagcca
tcttcaagatttgcagatcaaaaaaatcctccaaatcagtcttccaatgaaagaccacca
tctcttcttgtgatagaaaccaaaaaacctccacttaaaaaaggagagaaagaaaagaaa
aaaagcaatttggaactcttcaaagaagaattaaagcaaattcaagaggaacgtgatgag
agacataaaacaaaaggcagattaagtcgatttgaacctcctcagtcagattctgatggt
cagcgtcgttctatggacgcgccttcaagaagaaatagatcatctggtgttcttgatgat
tacgcacctggctcacatgatgtaggagatccaagcactactaatttataccttggaaac
attaatccacagatgaatgaagaaatgctgtgccaagaatttggaagatttggaccgtta
gccagtgtgaaaatcatgtggcctagaactgatgaagaaagagccagagagagaaattgc
ggctttgtggcctttatgaatagaagagatgctgaaagagctttaaaaaatttgaatgga
aaaatgattatgtcttttgaaatgaagttaggttggggtaaagctgtacctattcctcca
catccaatatacattccgccttctatgatggaacatacgcttcccccacctccatccgga
ctgccttttaatgcgcagcctagagagcggttaaaaaaccctaatgctcctatgttaccg
ccacctaaaaacaaagaggattttgagaagactctgtcgcaagccatagtcaaagtggtt
atcccaacagaaaggaatttgctcgccctgatacatcgaatgatagagtttgttgtacgt
gaagggccaatgtttgaagctatgattatgaacagagaaatcaacaatcctatgttcagg
ttcttatttgaaaaccagacaccagcccatgtttactataggtggaagctttattctatt
ctgcagggagattctccaactaaatggcggacggaagattttcgtatgttcaaaaatgga
tctttttggaggccaccaccattaaatccgtacttgcatggaatgtcagaagagcaagaa
acagaagcttttgtagaggaacctagtaaaaagggagcacttaaggaagaacagagggat
aaattggaagaaatcttgcggggattaactccaaggaaaaatgatattggagatgcaatg
gttttctgtcttaataatgctgaagctgctgaagaaatagtggattgcattactgagtcg
ttgtccatcttaaagacaccccttcctaaaaagattgccagattatatttggtttctgat
gttttgtacaactcttcagccaaagttgctaatgcttcatattatagaaaattttttgaa
acaaagttatgtcagatattttcagacctcaatgccacctatcgtacaattcaaggccat
ttacaatctgaaaactttaagcaacgggtaatgacttgcttcagagcatgggaagattgg
gcaatttatccagaaccatttttgatcaaactacaaaatattttcttaggacttgtaaat
attattgaagaaaaggaaacagaggatgttccagatgaccttgatggtgcccccatcgag
gaagagcttgatggtgcacctctggaagatgtagatggaattcctattgatgctactccc
atcgatgatcttgatggagtccctataaaaagtcttgatgatgatcttgatggagtgcct
ttggatgcaactgaagactcaaaaaagaatgagcctatatttaaagttgccccatcaaaa
tgggaagctgtggatgaatctgaattggaagcacaggctgttacaacttctaaatgggaa
ttatttgaccagcatgaagaatcagaagaagaagaaaatcaaaatcaagaagaagaaagt
gaagatgaagaagatactcaaagttccaaatctgaagaacatcatttgtactctaatcca
atcaaagaagaaatgactgagtctaagttctctaagtactctgaaatgagtgaggaaaaa
cgagccaaacttcgtgaaattgagctcaaagttatgaagtttcaggatgaattggaatct
gggaaaagacctaaaaaaccaggccagagttttcaggagcaagtagaacactacagagat
aaacttcttcaacgagagaaagagaaagagttagaaagagaacgagaaagagacaagaaa
gataaagaaaaattggaatctcgctccaaagacaagaaggaaaaagatgagtgtactccg
acaaggaaggaaaggaagaggcgacacagtacatcccccagcccatctcgcagtagcagt
ggtagacgagtgaaatccccatcaccaaaatcggagcgatcagagcgttcagaaagatct
cataaagagagctcacggtccaggtcatctcacaaagattctcctagagatgttagcaaa
aaagccaaaagatcaccatctggttcaaggacacctaaaaggtctaggcgatcacggtct
agatctcctaaaaaatcaggaaagaagtccagatcccagtccagatctccacacaggtct
cataaaaagtcaaagaaaaacaaacactga

DBGET integrated database retrieval system