KEGG   Homo sapiens (human): 23362Help
Entry
23362             CDS       T01001                                 

Gene name
PSD3, EFA6D, EFA6R, HCA67
Definition
(RefSeq) pleckstrin and Sec7 domain containing 3
  KO
K12494  
PH and SEC7 domain-containing protein
Organism
hsa  Homo sapiens (human)
Pathway
Endocytosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    23362 (PSD3)
Membrane trafficking [BR:hsa04131]
 Endocytosis
  Arf GTPases and associated proteins
   Arf associated proteins
    23362 (PSD3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
Q9NYI0(Tbio)
UniProt: 
Position
8p22
AA seq 1047 aa AA seqDB search
MEGRSAAAETFVWVNNASAHSQSVAKAKYEFLFGRSEGKAPDTSDHGGSTLLPPNVTNEF
PEYGTMEEGGEGLRASLEFDGEALPCHPQEQQGVQPLTGCHSGLDSVTEGPKDVREAPSQ
SHLKEQSLQPIDSLISALKATEARIISGTLQATKVLDQDAVSSFSVQQVEKELDTASRKT
QRVNKTLPAGQKNLPEIPLSAEVTTEESFYLSIQKDLTALLTGDTQAEISQIMNNGRKGA
VCVQEPSCPLASLGSSAVTCHSAGSVGFLKEQRSALGREHPGGCDRSSSMGRPGRVKHVE
FQGVEILWTGGDKRETQHPIDFETSLQRTASPDSKESSKVPRHLISSAGLCNSSSLTENV
WDESWKAPSERPGTSSGTFSPVRLDESGEDEVFLQENKQHLEKTPKPERDRERISEQEEH
VKGEDEDILGPGYTEDSTDVYSSQFETILDNTSLYYSAESLETLYSEPDSYFSFEMPLTP
MIQQRIKEGGQFLERTSGGGHQDILSVSADGGIVMGYSSGVTNGLNDASDSIYTKGTPEI
AFWGSNAGVKTTRLEAHSEMGSTEILEKETPENLSNGTSSNVEAAKRLAKRLYQLDRFKR
SDVAKHLGKNNEFSKLVAEEYLKFFDFTGMTLDQSLRYFFKAFSLVGETQERERVLIHFS
NRYFYCNPDTIASQDGVHCLTCAIMLLNTDLHGHNIGKKMTCQEFIANLQGVNEGVDFSK
DLLKALYNSIKNEKLEWAVDDEEKKKSPSESTEEKANGTHPKTISRIGSTTNPFLDIPHD
PNAAVYKSGFLARKIHADMDGKKTPRGKRGWKTFYAVLKGTVLYLQKDEYKPEKALSEED
LKNAVSVHHALASKATDYEKKPNVFKLKTADWRVLLFQTQSPEEMQGWINKINCVAAVFS
APPFPAAIGSQKKFSRPLLPATTTKLSQEEQLKSHESKLKQITTELAEHRSYPPDKKVKA
KDVDEYKLKDHYLEFEKTRYEMYVSILKEGGKELLSNDESEAAGLKKSHSSPSLNPDTSP
ITAKVKRNVSERKDHRPETPSIKQKVT
NT seq 3144 nt NT seq  +upstreamnt  +downstreamnt
atggaaggaaggagcgcagcggcagagacatttgtttgggtgaacaatgcatctgcacat
tcccagagtgttgccaaggccaaatatgaatttttatttggcagatctgaagggaaagct
ccagatactagtgatcatggaggaagcactttactcccaccaaatgtcacaaatgaattt
ccagaatatgggaccatggaggaaggtggagaaggcctaagggcttctctggaatttgat
ggtgaggctctgccatgccacccacaagagcagcagggtgtccagcctcttactggctgc
cactctgggctcgacagtgttacagaaggaccaaaagatgtcagagaggccccctctcaa
agtcatctcaaggaacaaagtttacagcccattgactctttgatttcagctctgaaagcc
acagaagccagaatcatttccggaacattacaggctacaaaggtactggaccaagatgct
gtttctagtttttcagttcagcaggtggaaaaagagctggacactgccagtcgtaaaaca
cagagagtcaacaaaacgctccctgctggccaaaaaaatttaccagaaatacctctttca
gctgaagtaacaacggaggaaagtttttatttgagcatccagaaagatctcaccgcgctg
ttaactggagacactcaggcagagatttcccagataatgaataatgggaggaaaggggct
gtctgtgtgcaggagccatcttgtcctttggcctccctcgggagctcagcagtgacctgc
cactctgcaggcagtgttggtttcttgaaagagcagaggtctgctcttgggagagagcac
ccagggggatgtgatcgaagcagctccatgggacgcccaggccgggtcaaacatgtggaa
tttcaaggagtggaaatactgtggacaggaggagacaagagagagacccagcatcctata
gattttgagacatcactgcaaagaacagcctctcctgacagcaaagagtcttccaaagtg
ccacgccatctcatctcatcagctggtttgtgtaattcaagtagtttaactgagaatgtt
tgggatgaatcctggaaagctccttcagagaggcctggcactagctcggggacattttcc
cctgtgcgtcttgatgagagtggagaggatgaagtcttcctacaggaaaacaaacagcat
cttgagaagacacctaaaccagagagagacagggaaaggatcagcgaacaagaggagcac
gttaagggggaagatgaagacatccttgggcctggatatacggaggactccaccgacgtg
tacagctcccagtttgaaaccattttggacaacacttctttatactacagtgcagagtcc
ctggagacattatactcagagcctgatagctattttagctttgaaatgcccctcactcca
atgatacaacagcgcattaaagaaggtggtcagttcttggagaggacatcagggggagga
catcaggatatcctgagtgtgtctgcagatggtggcatcgtgatgggctattctagtggc
gtcaccaatgggctgaatgatgccagcgactccatctacacgaaaggcaccccggagatt
gctttctggggaagcaatgctggggtgaaaacaacacggctagaagctcattctgaaatg
gggagcactgaaattttggaaaaggagaccccagaaaatctcagtaatggtaccagcagc
aatgtggaagcagccaaaaggttggccaaacgcctttatcagctggacagattcaaaaga
tcagatgttgcaaaacaccttggcaagaacaacgaatttagcaaactagttgcagaagaa
tatctgaagttttttgattttacaggaatgacgctggatcagtcactcaggtatttcttt
aaagcattctctcttgtgggagaaactcaagaacgagagagagttttaatacacttctcc
aatagatatttttattgtaacccagataccattgcttcacaagatggagtccattgcctt
acctgtgcaataatgcttcttaataccgatctacatggccacaatattggaaagaagatg
acctgtcaggagttcattgcaaatctgcaaggggtaaatgagggtgttgatttctccaag
gatctgctgaaagctctgtacaactcaatcaagaatgagaagcttgaatgggcagtagat
gatgaagagaaaaaaaagtctccctcagaaagtactgaggagaaagctaacggaacacat
ccaaagaccatcagtcgtattggaagtactactaacccatttttggacattcctcatgat
ccaaatgctgctgtgtacaaaagtggattcttggctcggaaaattcatgcagatatggat
ggaaagaagactccaagaggaaaacgaggatggaaaaccttttatgctgtactgaaggga
acagttctttacttgcaaaaggatgaatacaagccagaaaaggccttgtctgaagaggac
ttgaaaaacgctgtgagtgtgcaccacgcattggcatccaaggccacggactatgagaag
aaaccaaacgtgtttaaacttaaaactgccgactggagggtcttgctttttcaaactcag
agcccagaggaaatgcaagggtggataaacaaaatcaattgtgtggcagctgtattttct
gcaccaccatttccagcagcaatcggctctcagaagaagtttagccgcccacttctgcct
gccactacaacaaaactgtctcaggaggagcaactgaagtcacatgaaagtaagctgaag
cagatcaccaccgagctggccgagcaccgctcatatccccccgacaagaaggtcaaagcc
aaggacgtcgatgagtacaaactgaaagaccactatctggagtttgagaaaacccgctat
gaaatgtatgtcagcattctcaaggaaggaggcaaagagctactgagtaacgatgaaagc
gaggctgcaggactgaagaagtcgcactcgagtccttcgctgaacccggatacttctcca
atcactgccaaagtcaagcgtaacgtgtcagagaggaaggatcaccgacctgaaacacca
agcattaagcaaaaagttacttag

DBGET integrated database retrieval system