KEGG   Homo sapiens (human): 23365Help
Entry
23365             CDS       T01001                                 

Gene name
ARHGEF12, LARG, PRO2792
Definition
Rho guanine nucleotide exchange factor (GEF) 12
Orthology
K07532  
Rho guanine nucleotide exchange factor 12
Organism
hsa  Homo sapiens (human)
Pathway
Vascular smooth muscle contraction
Axon guidance
Platelet activation
Regulation of actin cytoskeleton
Tuberculosis
Pathways in cancer
Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    23365 (ARHGEF12)
 Organismal Systems
  Immune system
   04611 Platelet activation
    23365 (ARHGEF12)
  Circulatory system
   04270 Vascular smooth muscle contraction
    23365 (ARHGEF12)
  Development
   04360 Axon guidance
    23365 (ARHGEF12)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    23365 (ARHGEF12)
   05205 Proteoglycans in cancer
    23365 (ARHGEF12)
  Infectious diseases
   05152 Tuberculosis
    23365 (ARHGEF12)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
11q23.3
AA seq 1525 aa AA seqDB search
MSGTQSTITDRFPLKKPIRHGSILNRESPTDKKQKVERIASHDFDPTGLVQRCVIIQKDD
NGFGLTVSGDNPVFVQSVKEDGAAMRAGVQTGDRIIKVNGTLVTHSNHLEVVKLIKSGSY
VALTVQGRPPGSPQIPLADSEVEPSVIGHMSPIMTSPHSPGASGNMERITSPVLMGEENN
VVHNQKVEILRKMLQKEQERLQLLQEDYNRTPAQRLLKEIQEAKKHIPQLQEQLSKATGS
AQDGAVVTPSRPLGDTLTVSEAETDPGDVLGRTDCSSGDASRPSSDNADSPKSGPKERIY
LEENPEKSETIQDTDTQSLVGSPSTRIAPHIIGAEDDDFGTEHEQINGQCSCFQSIELLK
SRPAHLAVFLHHVVSQFDPATLLCYLYSDLYKHTNSKETRRIFLEFHQFFLDRSAHLKVS
VPDEMSADLEKRRPELIPEDLHRHYIQTMQERVHPEVQRHLEDFRQKRSMGLTLAESELT
KLDAERDKDRLTLEKERTCAEQIVAKIEEVLMTAQAVEEDKSSTMQYVILMYMKHLGVKV
KEPRNLEHKRGRIGFLPKIKQSMKKDKEGEEKGKRRGFPSILGPPRRPSRHDNSAIGRAM
ELQKARHPKHLSTPSSVSPEPQDSAKLRQSGLANEGTDAGYLPANSMSSVASGASFSQEG
GKENDTGSKQVGETSAPGDTLDGTPRTLNTVFDFPPPPLDQVQEEECEVERVTEHGTPKP
FRKFDSVAFGESQSEDEQFENDLETDPPNWQQLVSREVLLGLKPCEIKRQEVINELFYTE
RAHVRTLKVLDQVFYQRVSREGILSPSELRKIFSNLEDILQLHIGLNEQMKAVRKRNETS
VIDQIGEDLLTWFSGPGEEKLKHAAATFCSNQPFALEMIKSRQKKDSRFQTFVQDAESNP
LCRRLQLKDIIPTQMQRLTKYPLLLDNIAKYTEWPTEREKVKKAADHCRQILNYVNQAVK
EAENKQRLEDYQRRLDTSSLKLSEYPNVEELRNLDLTKRKMIHEGPLVWKVNRDKTIDLY
TLLLEDILVLLQKQDDRLVLRCHSKILASTADSKHTFSPVIKLSTVLVRQVATDNKALFV
ISMSDNGAQIYELVAQTVSEKTVWQDLICRMAASVKEQSTKPIPLPQSTPGEGDNDEEDP
SKLKEEQHGISVTGLQSPDRDLGLESTLISSKPQSHSLSTSGKSEVRDLFVAERQFAKEQ
HTDGTLKEVGEDYQIAIPDSHLPVSEERWALDALRNLGLLKQLLVQQLGLTEKSVQEDWQ
HFPRYRTASQGPQTDSVIQNSENIKAYHSGEGHMPFRTGTGDIATCYSPRTSTESFAPRD
SVGLAPQDSQASNILVMDHMIMTPEMPTMEPEGGLDDSGEHFFDAREAHSDENPSEGDGA
VNKEEKDVNLRISGNYLILDGYDPVQESSTDEEVASSLTLQPMTGIPAVESTHQQQHSPQ
NTHSDGAISPFTPEFLVQQRWGAMEYSCFEIQSPSSCADSQSQIMEYIHKIEADLEHLKK
VEESYTILCQRLAGSALTDKHSDKS
NT seq 4578 nt NT seq  +upstreamnt  +downstreamnt
atgagtggcacacagtctactatcaccgacaggtttcccctcaaaaaacctataaggcat
ggaagtattttgaaccgagagtcaccaacagataagaagcagaaagttgagcgcattgca
tcacatgattttgaccccacaggtcttgttcagcgttgcgtaatcatccagaaagatgac
aatggatttgggctgacggtcagtggagacaatccagtcttcgtacagtctgtcaaagaa
gatggagcagccatgcgggctggagtacagacaggtgatcgaatcatcaaggtgaatgga
actctggtgactcattcaaatcatctggaggtggtgaagctaatcaaatctggttcctat
gtagctctcactgttcagggacgcccacctgggtcgccccagattccacttgccgactct
gaagtagagccgtcagtcattggacatatgtctcccatcatgacatctcctcattcacct
ggagcatctgggaatatggagagaatcactagtcctgtgctcatgggggaggaaaacaat
gtggttcataaccagaaagtagaaattctgagaaaaatgttacagaaagaacaggaacgg
ctacagttattgcaggaagattacaaccgaacacctgcccaaagattgctaaaagagatc
caagaggccaagaaacacattcctcagctgcaagagcagttatccaaagccacaggctct
gctcaggatggagctgtagttacaccctccagacctttaggggacaccctaacagtcagt
gaggcagaaacagatcctggagatgtactgggcaggactgactgtagcagtggagatgct
tctcggcccagtagtgacaatgcagatagtcccaagagtggcccaaaagagagaatttat
ctagaggaaaacccagagaaaagtgaaacaattcaggacactgacactcaatcacttgtc
ggaagtccctcaacccgtatagcacctcatattattggagcagaagatgatgattttggt
actgaacatgaacagatcaatggacagtgcagctgtttccagagcattgaattactaaaa
tctcgcccggctcatttggctgttttcttacaccatgtagtttcacaatttgaccctgcg
actttgctctgttatctctattcagacctgtataaacataccaattccaaagaaactcgt
cgcatcttccttgagtttcatcagttctttctagatcgatcagcacacctgaaagtttct
gttcctgatgaaatgtctgcagatctagaaaagagaagacctgagctcattcctgaggat
ctgcatcgccactatatccaaactatgcaagaaagagtccatccagaagttcaaaggcac
ttagaagattttcggcagaaacgtagtatgggactgaccttggctgaaagcgagctgact
aaacttgatgcagagcgagacaaggaccgattgactttggagaaggagcggacatgtgca
gaacagattgttgccaaaattgaagaagtattgatgactgctcaggctgtagaggaagat
aagagctccaccatgcagtatgttattctcatgtatatgaagcatttgggagtaaaagtg
aaagagcctcgaaatttggagcacaaacggggtcggattggatttcttcccaaaatcaag
caaagtatgaagaaagataaagaaggggaagaaaaagggaagcgaagaggattccccagc
atcctgggacccccacggagaccaagccgtcatgacaacagtgcaattggcagagccatg
gaactacagaaggcgcgccaccctaagcacttatccacaccctcatctgtgagtcctgaa
cctcaggactctgccaagttgcgccagagtgggttagcaaatgaaggaacagacgctgga
tacctgcctgccaattccatgtcttctgtagcttcaggggcctctttttcccaggaagga
gggaaagagaatgatacaggatcaaagcaagttggagaaacatcagcacctggagacacc
ttagatggcacacctcgtactctcaatactgtctttgatttcccaccacctccattagac
caagtgcaggaggaggaatgtgaagtagaaagggtgactgaacatgggacaccaaagccc
tttcgaaagtttgacagtgtagcttttggagaaagtcaaagtgaggatgaacaatttgaa
aatgacttagagacagatccacccaactggcagcagcttgttagtcgagaagtgttactg
ggactaaaaccttgtgaaatcaaaagacaggaagtgattaatgaattgttctacactgaa
agagctcatgttcgaacactgaaggttcttgatcaagtgttctatcagcgagtatccaga
gaaggaattctgtcaccctcagagctacggaaaattttttcaaacttggaagatattctt
caacttcatattggattgaatgaacaaatgaaggctgttcgaaagagaaatgagacctct
gttatcgatcagattggggaagatttgctgacatggttcagcggaccaggagaggagaaa
ttgaaacatgctgctgctaccttttgcagtaaccaacctttcgccctggaaatgatcaaa
tctcgtcagaaaaaggattctcgatttcagacttttgtgcaagatgctgaaagtaatcca
ctgtgtcgtcgtcttcaactgaaggatattattcccactcaaatgcaaaggcttactaag
tacccacttctgttggataatattgccaaatacacagaatggccaacagaaagggagaag
gtgaagaaagctgcagatcactgtcgtcagatcttaaattatgtaaatcaggctgtcaag
gaggcagaaaacaagcagcgcctagaagattatcagcgtcgccttgatacctccagcctg
aagttgtcagagtacccaaatgttgaagagctcaggaatttggatttaacaaaaaggaag
atgattcatgaagggccattggtttggaaggtgaatagagataaaactattgatttatac
acgttgctgctggaagacattcttgtattgttacaaaagcaggatgatagactggtttta
aggtgtcatagtaagattctggcatctacagctgatagcaaacacacgtttagccctgtc
attaagttgagtacagtgttggttcgacaagtggcaacagataacaaagctttattcgtc
atttccatgtcagacaatggcgctcagatttatgaactggtggcacagacagtttctgaa
aagactgtctggcaggacctaatctgtcggatggctgcatcagtgaaggagcaatccaca
aagccaattccattaccacagtcaacacctggcgaaggagataatgatgaagaagatcct
tcaaaattaaaagaggagcagcatggcatttcagtcactggtttgcagagtccagacaga
gatttgggattagaatctaccttaatatcgtcaaaacctcagtctcattcactgagtacc
tctgggaaatcagaggtacgtgatctgtttgtggctgagagacagtttgcaaaggaacaa
catacagatgggacactaaaggaagttggagaagattatcaaatcgcaatcccagattca
cacctgcctgtctcagaagaacggtgggcattggatgcactaagaaatttgggtttgttg
aagcagttgctggtgcaacagctaggtttgactgagaagagcgttcaggaagactggcaa
catttcccaagatacagaacagcctctcaggggccgcagacagacagtgtcatccagaac
tctgaaaatattaaggcctatcattctggtgaaggacatatgccctttagaactggaact
ggtgacattgcaacttgttacagtccacggacttcaactgaatcttttgctccacgggat
tcagtgggactggcaccccaggatagccaggcaagtaacattttagtaatggaccacatg
attatgaccccagagatgcctaccatggagccagaagggggtcttgatgacagtggagag
cacttttttgatgcccgtgaagcacatagtgatgagaatccatcagaaggtgatggagca
gttaacaaggaagagaaggatgttaatttacgcatctcaggaaactatttgatccttgat
ggctatgacccagtgcaggagagttccacagatgaggaggttgcttcctcacttaccctg
cagcccatgacaggcatccctgctgtggaatccacccaccagcagcaacattctcctcag
aatactcactccgatggggcaatttcaccattcacccccgaatttctggtccagcagcgc
tggggagctatggagtattcctgttttgagatccagagtccctcctcttgtgcagattca
cagagccagatcatggagtacattcataagatagaggctgaccttgaacacttaaagaag
gtggaggaaagttacaccattctttgccaaaggctggctggatcagccctcacagacaag
cactcagataaaagttag

DBGET integrated database retrieval system