KEGG   Homo sapiens (human): 23365Help
Entry
23365             CDS       T01001                                 

Gene name
ARHGEF12, LARG, PRO2792
Definition
(RefSeq) Rho guanine nucleotide exchange factor 12
  KO
K07532  Rho guanine nucleotide exchange factor 12
Organism
hsa  Homo sapiens (human)
Pathway
hsa04270  Vascular smooth muscle contraction
hsa04360  Axon guidance
hsa04611  Platelet activation
hsa04625  C-type lectin receptor signaling pathway
hsa04810  Regulation of actin cytoskeleton
hsa05152  Tuberculosis
hsa05200  Pathways in cancer
hsa05205  Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    23365 (ARHGEF12)
 Organismal Systems
  Immune system
   04611 Platelet activation
    23365 (ARHGEF12)
   04625 C-type lectin receptor signaling pathway
    23365 (ARHGEF12)
  Circulatory system
   04270 Vascular smooth muscle contraction
    23365 (ARHGEF12)
  Development
   04360 Axon guidance
    23365 (ARHGEF12)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    23365 (ARHGEF12)
   05205 Proteoglycans in cancer
    23365 (ARHGEF12)
  Infectious diseases
   05152 Tuberculosis
    23365 (ARHGEF12)
Membrane trafficking [BR:hsa04131]
 Others
  Rho GTPase associated proteins
   Rho guanine nucleotide exchange factors (GEFs)
    23365 (ARHGEF12)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RGS-like RhoGEF PDZ PDZ_2 PH_13 Ribonuc_2-5A
Motif
Other DBs
NCBI-GeneID: 23365
NCBI-ProteinID: NP_056128
OMIM: 604763
HGNC: 14193
Ensembl: ENSG00000196914
Vega: OTTHUMG00000166143
Pharos: Q9NZN5(Tbio)
UniProt: Q9NZN5 B4E2K6
Structure
PDB: 

Jmol
Position
11q23.3
AA seq 1544 aa AA seqDB search
MSGTQSTITDRFPLKKPIRHGSILNRESPTDKKQKVERIASHDFDPTDSSSKKTKSSSEE
SRSEIYGLVQRCVIIQKDDNGFGLTVSGDNPVFVQSVKEDGAAMRAGVQTGDRIIKVNGT
LVTHSNHLEVVKLIKSGSYVALTVQGRPPGSPQIPLADSEVEPSVIGHMSPIMTSPHSPG
ASGNMERITSPVLMGEENNVVHNQKVEILRKMLQKEQERLQLLQEDYNRTPAQRLLKEIQ
EAKKHIPQLQEQLSKATGSAQDGAVVTPSRPLGDTLTVSEAETDPGDVLGRTDCSSGDAS
RPSSDNADSPKSGPKERIYLEENPEKSETIQDTDTQSLVGSPSTRIAPHIIGAEDDDFGT
EHEQINGQCSCFQSIELLKSRPAHLAVFLHHVVSQFDPATLLCYLYSDLYKHTNSKETRR
IFLEFHQFFLDRSAHLKVSVPDEMSADLEKRRPELIPEDLHRHYIQTMQERVHPEVQRHL
EDFRQKRSMGLTLAESELTKLDAERDKDRLTLEKERTCAEQIVAKIEEVLMTAQAVEEDK
SSTMQYVILMYMKHLGVKVKEPRNLEHKRGRIGFLPKIKQSMKKDKEGEEKGKRRGFPSI
LGPPRRPSRHDNSAIGRAMELQKARHPKHLSTPSSVSPEPQDSAKLRQSGLANEGTDAGY
LPANSMSSVASGASFSQEGGKENDTGSKQVGETSAPGDTLDGTPRTLNTVFDFPPPPLDQ
VQEEECEVERVTEHGTPKPFRKFDSVAFGESQSEDEQFENDLETDPPNWQQLVSREVLLG
LKPCEIKRQEVINELFYTERAHVRTLKVLDQVFYQRVSREGILSPSELRKIFSNLEDILQ
LHIGLNEQMKAVRKRNETSVIDQIGEDLLTWFSGPGEEKLKHAAATFCSNQPFALEMIKS
RQKKDSRFQTFVQDAESNPLCRRLQLKDIIPTQMQRLTKYPLLLDNIAKYTEWPTEREKV
KKAADHCRQILNYVNQAVKEAENKQRLEDYQRRLDTSSLKLSEYPNVEELRNLDLTKRKM
IHEGPLVWKVNRDKTIDLYTLLLEDILVLLQKQDDRLVLRCHSKILASTADSKHTFSPVI
KLSTVLVRQVATDNKALFVISMSDNGAQIYELVAQTVSEKTVWQDLICRMAASVKEQSTK
PIPLPQSTPGEGDNDEEDPSKLKEEQHGISVTGLQSPDRDLGLESTLISSKPQSHSLSTS
GKSEVRDLFVAERQFAKEQHTDGTLKEVGEDYQIAIPDSHLPVSEERWALDALRNLGLLK
QLLVQQLGLTEKSVQEDWQHFPRYRTASQGPQTDSVIQNSENIKAYHSGEGHMPFRTGTG
DIATCYSPRTSTESFAPRDSVGLAPQDSQASNILVMDHMIMTPEMPTMEPEGGLDDSGEH
FFDAREAHSDENPSEGDGAVNKEEKDVNLRISGNYLILDGYDPVQESSTDEEVASSLTLQ
PMTGIPAVESTHQQQHSPQNTHSDGAISPFTPEFLVQQRWGAMEYSCFEIQSPSSCADSQ
SQIMEYIHKIEADLEHLKKVEESYTILCQRLAGSALTDKHSDKS
NT seq 4635 nt NT seq  +upstreamnt  +downstreamnt
atgagtggcacacagtctactatcaccgacaggtttcccctcaaaaaacctataaggcat
ggaagtattttgaaccgagagtcaccaacagataagaagcagaaagttgagcgcattgca
tcacatgattttgaccccacagatagctcctccaagaagacaaagtctagttcagaggag
agtagatccgagatatatggtcttgttcagcgttgcgtaatcatccagaaagatgacaat
ggatttgggctgacggtcagtggagacaatccagtcttcgtacagtctgtcaaagaagat
ggagcagccatgcgggctggagtacagacaggtgatcgaatcatcaaggtgaatggaact
ctggtgactcattcaaatcatctggaggtggtgaagctaatcaaatctggttcctatgta
gctctcactgttcagggacgcccacctgggtcgccccagattccacttgccgactctgaa
gtagagccgtcagtcattggacatatgtctcccatcatgacatctcctcattcacctgga
gcatctgggaatatggagagaatcactagtcctgtgctcatgggggaggaaaacaatgtg
gttcataaccagaaagtagaaattctgagaaaaatgttacagaaagaacaggaacggcta
cagttattgcaggaagattacaaccgaacacctgcccaaagattgctaaaagagatccaa
gaggccaagaaacacattcctcagctgcaagagcagttatccaaagccacaggctctgct
caggatggagctgtagttacaccctccagacctttaggggacaccctaacagtcagtgag
gcagaaacagatcctggagatgtactgggcaggactgactgtagcagtggagatgcttct
cggcccagtagtgacaatgcagatagtcccaagagtggcccaaaagagagaatttatcta
gaggaaaacccagagaaaagtgaaacaattcaggacactgacactcaatcacttgtcgga
agtccctcaacccgtatagcacctcatattattggagcagaagatgatgattttggtact
gaacatgaacagatcaatggacagtgcagctgtttccagagcattgaattactaaaatct
cgcccggctcatttggctgttttcttacaccatgtagtttcacaatttgaccctgcgact
ttgctctgttatctctattcagacctgtataaacataccaattccaaagaaactcgtcgc
atcttccttgagtttcatcagttctttctagatcgatcagcacacctgaaagtttctgtt
cctgatgaaatgtctgcagatctagaaaagagaagacctgagctcattcctgaggatctg
catcgccactatatccaaactatgcaagaaagagtccatccagaagttcaaaggcactta
gaagattttcggcagaaacgtagtatgggactgaccttggctgaaagcgagctgactaaa
cttgatgcagagcgagacaaggaccgattgactttggagaaggagcggacatgtgcagaa
cagattgttgccaaaattgaagaagtattgatgactgctcaggctgtagaggaagataag
agctccaccatgcagtatgttattctcatgtatatgaagcatttgggagtaaaagtgaaa
gagcctcgaaatttggagcacaaacggggtcggattggatttcttcccaaaatcaagcaa
agtatgaagaaagataaagaaggggaagaaaaagggaagcgaagaggattccccagcatc
ctgggacccccacggagaccaagccgtcatgacaacagtgcaattggcagagccatggaa
ctacagaaggcgcgccaccctaagcacttatccacaccctcatctgtgagtcctgaacct
caggactctgccaagttgcgccagagtgggttagcaaatgaaggaacagacgctggatac
ctgcctgccaattccatgtcttctgtagcttcaggggcctctttttcccaggaaggaggg
aaagagaatgatacaggatcaaagcaagttggagaaacatcagcacctggagacacctta
gatggcacacctcgtactctcaatactgtctttgatttcccaccacctccattagaccaa
gtgcaggaggaggaatgtgaagtagaaagggtgactgaacatgggacaccaaagcccttt
cgaaagtttgacagtgtagcttttggagaaagtcaaagtgaggatgaacaatttgaaaat
gacttagagacagatccacccaactggcagcagcttgttagtcgagaagtgttactggga
ctaaaaccttgtgaaatcaaaagacaggaagtgattaatgaattgttctacactgaaaga
gctcatgttcgaacactgaaggttcttgatcaagtgttctatcagcgagtatccagagaa
ggaattctgtcaccctcagagctacggaaaattttttcaaacttggaagatattcttcaa
cttcatattggattgaatgaacaaatgaaggctgttcgaaagagaaatgagacctctgtt
atcgatcagattggggaagatttgctgacatggttcagcggaccaggagaggagaaattg
aaacatgctgctgctaccttttgcagtaaccaacctttcgccctggaaatgatcaaatct
cgtcagaaaaaggattctcgatttcagacttttgtgcaagatgctgaaagtaatccactg
tgtcgtcgtcttcaactgaaggatattattcccactcaaatgcaaaggcttactaagtac
ccacttctgttggataatattgccaaatacacagaatggccaacagaaagggagaaggtg
aagaaagctgcagatcactgtcgtcagatcttaaattatgtaaatcaggctgtcaaggag
gcagaaaacaagcagcgcctagaagattatcagcgtcgccttgatacctccagcctgaag
ttgtcagagtacccaaatgttgaagagctcaggaatttggatttaacaaaaaggaagatg
attcatgaagggccattggtttggaaggtgaatagagataaaactattgatttatacacg
ttgctgctggaagacattcttgtattgttacaaaagcaggatgatagactggttttaagg
tgtcatagtaagattctggcatctacagctgatagcaaacacacgtttagccctgtcatt
aagttgagtacagtgttggttcgacaagtggcaacagataacaaagctttattcgtcatt
tccatgtcagacaatggcgctcagatttatgaactggtggcacagacagtttctgaaaag
actgtctggcaggacctaatctgtcggatggctgcatcagtgaaggagcaatccacaaag
ccaattccattaccacagtcaacacctggcgaaggagataatgatgaagaagatccttca
aaattaaaagaggagcagcatggcatttcagtcactggtttgcagagtccagacagagat
ttgggattagaatctaccttaatatcgtcaaaacctcagtctcattcactgagtacctct
gggaaatcagaggtacgtgatctgtttgtggctgagagacagtttgcaaaggaacaacat
acagatgggacactaaaggaagttggagaagattatcaaatcgcaatcccagattcacac
ctgcctgtctcagaagaacggtgggcattggatgcactaagaaatttgggtttgttgaag
cagttgctggtgcaacagctaggtttgactgagaagagcgttcaggaagactggcaacat
ttcccaagatacagaacagcctctcaggggccgcagacagacagtgtcatccagaactct
gaaaatattaaggcctatcattctggtgaaggacatatgccctttagaactggaactggt
gacattgcaacttgttacagtccacggacttcaactgaatcttttgctccacgggattca
gtgggactggcaccccaggatagccaggcaagtaacattttagtaatggaccacatgatt
atgaccccagagatgcctaccatggagccagaagggggtcttgatgacagtggagagcac
ttttttgatgcccgtgaagcacatagtgatgagaatccatcagaaggtgatggagcagtt
aacaaggaagagaaggatgttaatttacgcatctcaggaaactatttgatccttgatggc
tatgacccagtgcaggagagttccacagatgaggaggttgcttcctcacttaccctgcag
cccatgacaggcatccctgctgtggaatccacccaccagcagcaacattctcctcagaat
actcactccgatggggcaatttcaccattcacccccgaatttctggtccagcagcgctgg
ggagctatggagtattcctgttttgagatccagagtccctcctcttgtgcagattcacag
agccagatcatggagtacattcataagatagaggctgaccttgaacacttaaagaaggtg
gaggaaagttacaccattctttgccaaaggctggctggatcagccctcacagacaagcac
tcagataaaagttag

DBGET integrated database retrieval system