KEGG   Homo sapiens (human): 23369Help
Entry
23369             CDS       T01001                                 

Gene name
PUM2, PUMH2, PUML2
Definition
(RefSeq) pumilio RNA binding family member 2
  KO
K17943  
pumilio RNA-binding family
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
2p24.1
AA seq 1064 aa AA seqDB search
MNHDFQALALESRGMGELLPTKKFWEPDDSTKDGQKGIFLGDDEWRETAWGASHHSMSQP
IMVQRRSGQGFHGNSEVNAILSPRSESGGLGVSMVEYVLSSSPADKLDSRFRKGNFGTRD
AETDGPEKGDQKGKASPFEEDQNRDLKQGDDDDSKINGRGLPNGMDADCKDFNRTPGSRQ
ASPTEVVERLGPNTNPSEGLGPLPNPTANKPLVEEFSNPETQNLDAMEQVGLESLQFDYP
GNQVPMDSSGATVGLFDYNSQQQLFQRTNALTVQQLTAAQQQQYALAAAQQPHIAGVFSA
GLAPAAFVPNPYIISAAPPGTDPYTAAGLAAAATLAGPAVVPPQYYGVPWGVYPANLFQQ
QAAAAANNTASQQAASQAQPGQQQVLRAGAGQRPLTPNQGQQGQQAESLAAAAAANPTLA
FGQGLATGMPGYQVLAPTAYYDQTGALVVGPGARTGLGAPVRLMAPTPVLISSAAAQAAA
AAAAGGTASSLTGSTNGLFRPIGTQPPQQQQQQPSTNLQSNSFYGSSSLTNSSQSSSLFS
HGPGQPGSTSLGFGSGNSLGAAIGSALSGFGSSVGSSASSSATRRESLSTSSDLYKRSSS
SLAPIGQPFYNSLGFSSSPSPIGMPLPSQTPGHSLTPPPSLSSHGSSSSLHLGGLTNGSG
RYISAAPGAEAKYRSASSTSSLFSSSSQLFPPSRLRYNRSDIMPSGRSRLLEDFRNNRFP
NLQLRDLIGHIVEFSQDQHGSRFIQQKLERATPAERQMVFNEILQAAYQLMTDVFGNYVI
QKFFEFGSLDQKLALATRIRGHVLPLALQMYGCRVIQKALESISSDQQSEMVKELDGHVL
KCVKDQNGNHVVQKCIECVQPQSLQFIIDAFKGQVFVLSTHPYGCRVIQRILEHCTAEQT
LPILEELHQHTEQLVQDQYGNYVIQHVLEHGRPEDKSKIVSEIRGKVLALSQHKFASNVV
EKCVTHASRAERALLIDEVCCQNDGPHSALYTMMKDQYANYVVQKMIDMAEPAQRKIIMH
KIRPHITTLRKYTYGKHILAKLEKYYLKNSPDLGPIGGPPNGML
NT seq 3195 nt NT seq  +upstreamnt  +downstreamnt
atgaatcatgattttcaagctcttgcattagaatctcggggaatgggagagcttttgcct
accaaaaagttttgggaacctgatgattcaacaaaagatggacaaaaaggcatatttctt
ggggatgatgaatggagagagactgcatggggagcttctcaccattcaatgtcccagcct
attatggtacagagaagatctggacagggttttcatggaaacagtgaagtaaatgcaata
ctgtctccgcgatcagaaagtggaggccttggtgtgagcatggtagaatatgtattaagt
tcttctcctgctgataaattggattctcgatttaggaagggaaattttggcactagagat
gctgaaacagatggacctgagaaaggagatcaaaaaggcaaggcttctccatttgaggag
gaccaaaacagagatcttaaacaaggagatgatgatgattctaaaataaatggcagaggt
ttgccaaatggaatggatgccgattgcaaagattttaatcgtactcctggaagtcgtcaa
gcctctccaactgaagtagttgagcgcttgggccccaatactaatccctcagaaggactg
gggcctcttcctaatcctacagctaataaaccacttgttgaagaattttcaaatcctgaa
actcagaatctggatgccatggaacaagttggtctggaatccttacagtttgactatcct
ggtaatcaggtaccaatggactcttcaggagctactgtaggcctttttgactacaattcc
cagcagcagctctttcagaggactaatgcactaacagttcaacagttaactgcagctcaa
cagcagcaatatgcattagcagcagctcagcagccacatatagctggtgtattctcagca
ggccttgctccagctgcatttgtgccaaatccatacattattagtgctgctcctccaggg
accgatccgtatactgcagcaggattggctgcagcagctacattagcaggtccagcagtg
gttccacctcagtattacggcgttccatggggggtgtatccagccaacttatttcagcag
caagctgcagctgcggcaaataacacagccagtcagcaagcagcatcacaagctcagcct
ggacagcaacaggttctccgtgctggagcaggtcagcgtcctcttactcccaatcagggt
cagcaagggcagcaagcagaatcacttgcggcagctgcagcagcaaatccaacattggct
tttggtcagggtcttgctactggcatgccaggctatcaagtactagctccaactgcctat
tatgatcagactggtgccttagtggttggccctggagcaaggactggccttggagctcca
gttcggttaatggctccaacacctgttttaattagttcagcagcagcacaagctgcagca
gcagcagcagctggaggaactgcaagtagccttacaggcagcacaaatggtctgtttcgg
ccaattggcactcagccaccacagcagcagcaacagcagccaagcactaatctgcaatct
aattcattttatggaagcagttctttgactaatagctcccagagtagttctttattttct
catggacctggtcaacctggaagtacatctcttggctttggaagtggtaactctttgggt
gctgctataggctcagccctcagtggatttggttcatcagttggcagttctgcaagtagt
agtgccacaaggagagagtctctatctactagctctgacttgtacaaaagatctagtagc
agcctagcacccatagggcaaccattttacaatagtctgggattttcctcctctccaagt
ccaataggcatgcctctgccaagccaaactccaggacattcacttacgccaccgccatca
ctttcatcacatggatcctcatccagtttgcatttaggaggactgacaaatggtagtggt
cgatatatctctgcagcacctggagcagaagcaaaatatcgaagtgcttcaagcacttcc
agtctatttagctccagcagccagctctttcctccttcccggcttcggtataataggtct
gatattatgccttctggccgcagtagattattggaagatttcagaaacaaccgcttccca
aaccttcagcttagagacttgattggacatatagttgagttttctcaagaccagcatggt
tctagattcatacagcaaaaactagagagagctactccagctgagcgacagatggtattt
aatgaaattctgcaagcagcctatcaattaatgactgatgtttttggcaactatgttata
cagaagttttttgagtttgggagtctggatcaaaaattagccctggctactcgtattcgt
ggtcatgttctacccttagccttgcagatgtatggctgccgcgttattcagaaagcatta
gaatctatttcttctgaccagcagagtgaaatggtaaaggagctggatggtcatgtgctc
aaatgtgtgaaagatcagaatggaaaccatgttgtacaaaaatgtatcgaatgtgttcag
ccacagtcactacagttcatcattgatgctttcaagggacaagtatttgtgctttcaact
catccttatggctgcagagtaattcagcgcatcctagagcattgcactgcagaacagacc
ttacctatcttagaagaactccaccaacatacagagcagttggtacaggatcagtatggc
aattatgttattcagcatgtactggaacacggtcgacctgaagacaagagcaaaattgtt
tccgaaatcaggggaaaggttttagccctgagtcaacacaaatttgccagcaatgtagta
gaaaagtgtgttactcatgcctcccgtgctgagagagctttactgattgacgaggtttgc
tgccagaatgatggtcctcacagtgccttatacaccatgatgaaggaccagtatgccaat
tacgtggttcaaaagatgattgatatggctgaacctgctcagagaaagataatcatgcac
aagattcgacctcacattactactttgcgcaaatacacatacgggaagcatatactggcc
aagttggaaaagtattatttgaagaatagcccggacctaggacctattggaggaccacca
aatggaatgctgtaa

DBGET integrated database retrieval system