KEGG   Homo sapiens (human): 23396Help
Entry
23396             CDS       T01001                                 

Gene name
PIP5K1C, LCCS3, PIP5K-GAMMA, PIP5Kgamma, PIPKIg_v4
Definition
phosphatidylinositol-4-phosphate 5-kinase, type I, gamma (EC:2.7.1.68)
Orthology
K00889  
1-phosphatidylinositol-4-phosphate 5-kinase [EC:2.7.1.68]
Organism
hsa  Homo sapiens (human)
Pathway
Inositol phosphate metabolism
Metabolic pathways
Phosphatidylinositol signaling system
Endocytosis
Focal adhesion
Fc gamma R-mediated phagocytosis
Regulation of actin cytoskeleton
Module
Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Disease
H00865  
Lethal congenital contractural syndrome (LCCS)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    23396 (PIP5K1C)
 Environmental Information Processing
  Signal transduction
   04070 Phosphatidylinositol signaling system
    23396 (PIP5K1C)
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    23396 (PIP5K1C)
  Cell motility
   04810 Regulation of actin cytoskeleton
    23396 (PIP5K1C)
  Cell communication
   04510 Focal adhesion
    23396 (PIP5K1C)
 Organismal Systems
  Immune system
   04666 Fc gamma R-mediated phagocytosis
    23396 (PIP5K1C)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.68  1-phosphatidylinositol-4-phosphate 5-kinase
     23396 (PIP5K1C)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
19p13.3
AA seq 640 aa AA seqDB search
MELEVPDEAESAEAGAVPSEAAWAAESGAAAGLAQKKAAPTEVLSMTAQPGPGHGKKLGH
RGVDASGETTYKKTTSSTLKGAIQLGIGYTVGHLSSKPERDVLMQDFYVVESIFFPSEGS
NLTPAHHFQDFRFKTYAPVAFRYFRELFGIRPDDYLYSLCNEPLIELSNPGASGSLFYVT
SDDEFIIKTVMHKEAEFLQKLLPGYYMNLNQNPRTLLPKFYGLYCVQSGGKNIRVVVMNN
ILPRVVKMHLKFDLKGSTYKRRASKKEKEKSFPTYKDLDFMQDMPEGLLLDADTFSALVK
TLQRDCLVLESFKIMDYSLLLGVHNIDQHERERQAQGAQSTSDEKRPVGQKALYSTAMES
IQGGAARGEAIESDDTMGGIPAVNGRGERLLLHIGIIDILQSYRFIKKLEHTWKALVHDG
DTVSVHRPSFYAERFFKFMSNTVFRKNSSLKSSPSKKGRGGALLAVKPLGPTAAFSASQI
PSEREEAQYDLRGARSYPTLEDEGRPDLLPCTPPSFEEATTASIATTLSSTSLSIPERSP
SETSEQPRYRRRTQSSGQDGRPQEEPPAEEDLQQITVQVEPACSVEIVVPKEEDAGVEAS
PAGASAAVEVETASQASDEEGAPASQASDEEDAPATDIYF
NT seq 1923 nt NT seq  +upstreamnt  +downstreamnt
atggagctggaggtaccggacgaggcggagagcgctgaggcgggggccgtgccctcggag
gcggcgtgggcggcagagagcggggcggcggcaggtttggctcagaagaaggcggcccca
acagaggttctgtccatgacggcacagccgggccctggccatgggaagaagttgggccat
cgaggtgtggacgcatccggcgaaaccacctacaagaagaccacctcctccaccctgaag
ggtgccatccagctgggcatcggctacaccgtgggccacctgagctccaagcccgaacgc
gacgtgctcatgcaggacttctacgtggtggagagcatcttcttccccagcgaaggcagc
aacctcacccccgcccaccacttccaggacttccgcttcaagacctatgcacctgtcgcc
ttccgctacttccgggagctctttgggatccggccagatgattacttgtactccctgtgc
aatgagccgctgatcgagctgtccaacccgggcgccagtggctccctcttctacgtcacc
agcgacgacgagttcatcatcaagaccgtcatgcacaaggaggccgagttcctgcagaag
ctgctccctggctactacatgaacctcaaccagaacccgcggacgctgctgcccaagttc
tatgggctgtactgcgtgcagtcggggggcaagaacatccgcgtcgtggtcatgaacaac
atcctgccccgcgtggtcaagatgcacctcaagttcgacctcaagggctccacctacaag
cggcgcgccagcaagaaggagaaggagaagagcttccccacctacaaggacctggacttc
atgcaggacatgcccgaggggctcctgctggacgccgacaccttcagcgccctggtcaag
acgctgcagcgggactgcctggtcctggaaagtttcaagatcatggactacagcctgctg
ctgggcgtgcacaacatcgaccagcacgagcgcgagcggcaggcgcagggcgcccagagc
acctcagatgagaagcggcctgtgggccagaaggcgctctactccacggccatggagtcc
atccagggtggcgccgcgcgcggggaggccatcgaatcggatgacacgatgggcgggatc
cccgctgtgaacggccgcggggagcggctgctgctgcacattggcatcatcgacatcctg
cagtcctacaggttcatcaagaaactggagcacacctggaaggccctcgtccacgatggg
gacacggtgtccgtccaccgccccagcttctatgccgagcgctttttcaagttcatgagc
aacacggtctttcggaagaactcctccctgaagtcctcgccctccaagaaggggcgcggc
ggagccttgctagctgtgaaaccgctggggcccaccgctgccttctcggccagccagatc
cctagcgagcgggaggaggcccagtacgacctgcggggggcccgcagctaccccacgctg
gaggacgaaggccggcccgacctcctgccctgcacgccaccttctttcgaagaagccact
acagcctccattgccacgactctgtcatccacatccctctccattcctgagcggtccccc
tcggagacgtcggagcagccgcggtacaggcggcgcacacagtcgtctggacaggatggc
aggccgcaggaggagccacccgcggaagaggatctgcagcagattacagtgcaggtggag
cctgcgtgcagcgtggagattgtggtccccaaagaggaggacgcaggggtggaggcttcc
ccggccggtgcctctgctgctgttgaagtagaaactgccagccaggcctcagacgaggag
ggcgcacctgccagccaggcctcggacgaggaggacgcgcccgccaccgacatctacttt
taa

DBGET integrated database retrieval system