KEGG   Homo sapiens (human): 23400Help
Entry
23400             CDS       T01001                                 

Gene name
ATP13A2, CLN12, HSA9947, KRPPD, PARK9
Definition
ATPase type 13A2 (EC:3.6.3.8)
Orthology
K13526  
cation-transporting ATPase 13A2 [EC:3.6.3.-]
Organism
hsa  Homo sapiens (human)
Disease
H00057  
Parkinson's disease (PD)
H00833  
Neurodegeneration with brain iron accumulation (NBIA)
Brite
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.3  Acting on acid anhydrides to catalyse transmembrane movement of substances
    3.6.3.-  
     23400 (ATP13A2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
1p36
AA seq 1175 aa AA seqDB search
MSADSSPLVGSTPTGYGTLTIGTSIDPLSSSVSSVRLSGYCGSPWRVIGYHVVVWMMAGI
PLLLFRWKPLWGVRLRLRPCNLAHAETLVIEIRDKEDSSWQLFTVQVQTEAIGEGSLEPS
PQSQAEDGRSQAAVGAVPEGAWKDTAQLHKSEEAKRVLRYYLFQGQRYIWIETQQAFYQV
SLLDHGRSCDDVHRSRHGLSLQDQMVRKAIYGPNVISIPVKSYPQLLVDEALNPYYGFQA
FSIALWLADHYYWYALCIFLISSISICLSLYKTRKQSQTLRDMVKLSMRVCVCRPGGEEE
WVDSSELVPGDCLVLPQEGGLMPCDAALVAGECMVNESSLTGESIPVLKTALPEGLGPYC
AETHRRHTLFCGTLILQARAYVGPHVLAVVTRTGFCTAKGGLVSSILHPRPINFKFYKHS
MKFVAALSVLALLGTIYSIFILYRNRVPLNEIVIRALDLVTVVVPPALPAAMTVCTLYAQ
SRLRRQGIFCIHPLRINLGGKLQLVCFDKTGTLTEDGLDVMGVVPLKGQAFLPLVPEPRR
LPVGPLLRALATCHALSRLQDTPVGDPMDLKMVESTGWVLEEEPAADSAFGTQVLAVMRP
PLWEPQLQAMEEPPVPVSVLHRFPFSSALQRMSVVVAWPGATQPEAYVKGSPELVAGLCN
PETVPTDFAQMLQSYTAAGYRVVALASKPLPTVPSLEAAQQLTRDTVEGDLSLLGLLVMR
NLLKPQTTPVIQALRRTRIRAVMVTGDNLQTAVTVARGCGMVAPQEHLIIVHATHPERGQ
PASLEFLPMESPTAVNGVKDPDQAASYTVEPDPRSRHLALSGPTFGIIVKHFPKLLPKVL
VQGTVFARMAPEQKTELVCELQKLQYCVGMCGDGANDCGALKAADVGISLSQAEASVVSP
FTSSMASIECVPMVIREGRCSLDTSFSVFKYMALYSLTQFISVLILYTINTNLGDLQFLA
IDLVITTTVAVLMSRTGPALVLGRVRPPGALLSVPVLSSLLLQMVLVTGVQLGGYFLTLA
QPWFVPLNRTVAAPDNLPNYENTVVFSLSSFQYLILAAAVSKGAPFRRPLYTNVPFLVAL
ALLSSVLVGLVLVPGLLQGPLALRNITDTGFKLLLLGLVTLNFVGAFMLESVLDQCLPAC
LRRLRPKRASKKRFKQLERELAEQPWPPLPAGPLR
NT seq 3528 nt NT seq  +upstreamnt  +downstreamnt
atgagcgcagacagcagccctctcgtgggcagcacgcccaccggttatgggaccctgacg
atagggacatcaatagatcccctcagctcctcagtttcatccgtgaggctcagcggctac
tgtggcagtccatggagggtcatcggctatcacgtcgtggtctggatgatggctgggatc
cctttgctgctcttccgttggaagcccctgtggggggtgcggctgcggctccggccctgc
aacctggcccacgccgaaacactcgttatcgaaataagagacaaagaggatagttcctgg
cagctcttcactgtccaggtgcagactgaggccatcggcgagggcagcctggagccgtcc
ccacagtcccaggcagaggatggccggagccaggcggcagttggggcggtaccagagggt
gcctggaaggatacggcccagctccacaagagcgaggaggcgaagcgggtgctgcggtat
tacctcttccagggccagcgctatatctggatcgagacccagcaagccttctaccaggtc
agcctcctggaccatggccgctcttgtgacgacgtccaccgctcccgccatggcctcagc
ctccaggaccaaatggtgaggaaggccatttacggccccaacgtgatcagcataccggtc
aagtcctacccccagctgctggtggacgaggcactgaacccctactatgggttccaggcc
ttcagcatcgcgctgtggctggctgaccactactactggtacgccctgtgcatcttcctc
atttcctccatctccatctgcctgtcgctgtacaagaccagaaagcaaagccagactcta
agggacatggtcaagttgtccatgcgggtgtgcgtgtgccggccagggggagaggaagag
tgggtggactccagtgagctagtgcccggagactgcctggtgctgccccaggagggtggg
ctgatgccctgtgatgccgccctggtggccggcgagtgcatggtgaatgagagctctctg
acaggagagagcattccagtgctgaagacggcactgccggaggggctggggccctactgt
gcagagacacaccggcggcacacactcttctgcgggaccctcatcttgcaggcccgggcc
tatgtgggaccgcacgtcctggcagtggtgacccgcacagggttctgcacggcaaaaggg
ggcctggtgagctccatcttgcacccccggcccatcaacttcaagttctataaacacagc
atgaagtttgtggctgccctctctgtcctggctctcctcggcaccatctacagcatcttc
atcctctaccgaaaccgggtgcctctgaatgagattgtaatccgggctctcgacctggtg
accgtggtggtgccacctgccctgcctgctgccatgactgtgtgcacgctctacgcccag
agccgactgcggagacagggcattttctgcatccacccactgcgcatcaacctggggggc
aagctgcagctggtgtgtttcgacaagacgggcaccctcactgaggacggcttagacgtg
atgggggtggtgcccctgaaggggcaggcattcctgcccctggtcccagagcctcgccgc
ctgcctgtggggcccctgctccgagcactggccacctgccatgccctcagccggctccag
gacacccccgtgggcgaccccatggacttgaagatggtggagtctactggctgggtcctg
gaggaagagccggctgcagactcagcatttgggacccaggtcttggcagtgatgagaccc
ccactttgggagccccagctgcaggcaatggaggagcccccggtgccagtcagcgtcctc
caccgcttccccttctcttcggctctgcagcgcatgagtgtggtggtggcgtggccaggg
gccactcagcccgaggcctacgtcaaaggctccccggagctggtggcagggctctgcaac
cccgagacagtgcccaccgacttcgcccagatgctgcagagctatacagctgctggctac
cgtgtcgtggccctggccagcaagccactgcccactgtgcccagcctggaggcagcccag
caactgacgagggacactgtggaaggagacctgagcctcctggggctgctggtcatgagg
aacctactgaagccgcagacaacgccagttatccaggctctgcgaaggacccgcatccgc
gccgtcatggtgacaggggacaacctgcagacagcggtgactgtggcccggggctgtggc
atggtggccccccaggagcatctgatcatcgtccacgccacccaccctgagcggggtcag
cctgcctctctcgagttcctgccgatggagtcccccacagccgtgaatggcgttaaggat
cctgaccaggctgcaagctacaccgtggagccagacccccgatccaggcacctggccctc
agcgggcccacctttggtatcattgtgaagcacttccccaagctgctgcccaaggtcctg
gtccagggcactgtctttgcccgcatggcccctgagcagaagacagagctggtgtgcgag
ctacagaagcttcagtactgcgtgggcatgtgcggagacggcgccaatgactgtggggcc
ctgaaggcggctgatgtcggcatctcgctgtcccaggcagaagcctcagtggtctcaccc
ttcacctcgagcatggccagtattgagtgcgtgcccatggtcatcagggaggggcgctgt
tcccttgacacttcgttcagcgtcttcaagtacatggctctgtacagcctgacccagttc
atctccgtcctgatcctctacacgatcaacaccaacctgggtgacctgcagttcctggcc
atcgacctggtcatcaccaccacagtggcagtgctcatgagccgcacggggccagcgctg
gtcctgggacgggtgcggccaccgggggcgctgctcagcgtgcccgtgctcagcagcctg
ctgctgcagatggtcctggtgaccggcgtgcagctagggggctacttcctgaccctggcc
cagccatggttcgtgcctctgaacaggacagtggccgcaccagacaacctgcccaactac
gagaacaccgtggtcttctctctgtccagcttccagtacctcatcctggctgcagccgtg
tccaagggggcgcccttccgccggccgctctacaccaatgtgcccttcctggtggccctg
gcgctcctgagctccgtcctggtgggccttgtcctggtccccggcctcctgcaggggccg
ctggcgctgaggaacatcactgacaccggcttcaagctgctgctgctgggtctggtcacc
ctcaacttcgtgggggccttcatgctggagagcgtgctagaccagtgcctccccgcctgc
ctgcgccgcctccggcccaagcgggcctccaagaagcgcttcaagcagctggaacgagag
ctggccgagcagccctggccgccgctgcccgccggccccctgaggtag

DBGET integrated database retrieval system