KEGG   Homo sapiens (human): 23401Help
Entry
23401             CDS       T01001                                 

Gene name
FRAT2, FRAT-2
Definition
(RefSeq) FRAT2, WNT signaling pathway regulator
  KO
K03096  
frequently rearranged in advanced T-cell lymphomas 2
Organism
hsa  Homo sapiens (human)
Pathway
Wnt signaling pathway
Pathways in cancer
Breast cancer
Hepatocellular carcinoma
Gastric cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04310 Wnt signaling pathway
    23401 (FRAT2)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    23401 (FRAT2)
   05225 Hepatocellular carcinoma
    23401 (FRAT2)
   05226 Gastric cancer
    23401 (FRAT2)
   05224 Breast cancer
    23401 (FRAT2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
O75474(Tdark)
UniProt: 
Position
10q24.1
AA seq 233 aa AA seqDB search
MPCRREEEEEAGEEAEGEEEEDDSFLLLQQSVTLGSSGEVDRLVAQIGETLQLDAAQDSP
ASPCAPPGVPLRAPGPLAAAVPADKARPPAVPLLLPPASAETVGPAPSGALRCALGDRGR
VRGRAAPYCVAEVAAGPSALPGPCRRGWLRDAVTSRRLQQRRWTQAGARAGDDDPHRLLQ
QLVLSGNLIKEAVRRLQRAVAAVAATGPASAPGPGGGRSGPDRIALQPSGSLL
NT seq 702 nt NT seq  +upstreamnt  +downstreamnt
atgccgtgccggagggaggaggaagaggaagccggcgaggaggcggagggggaggaagag
gaggacgacagcttcctcctgctgcagcagtcggtgacgctgggcagctcgggcgaggtg
gaccggctggtggcccagatcggcgagacgctgcagctggacgcggcgcaggacagcccg
gcctcgccgtgcgcgcccccgggggtgccgctgcgggccccggggcccctggctgcggcg
gtgccggcggacaaggcccggcccccggcggtgccgctgctgctgccgcccgcttcggct
gagacggtgggcccggcgccctctggggccctgcgctgcgccctaggggaccgcggccgc
gtgcgcggacgcgctgcgccctactgcgtggcggaggtcgccgcaggccccagcgcgctg
ccggggccgtgccggcgaggatggctcagggacgcggtcacctcccgccgcttgcagcag
cgccgatggacccaagccggggcacgcgccggcgacgacgacccgcatcggctcctccag
cagctcgtgctctcgggaaacctcatcaaggaagccgtgcggagactccaacgagccgtc
gccgcggttgcagccacgggccccgcaagcgcccctgggcccgggggaggccgcagcgga
cctgaccgcattgccctgcagccctcaggctccttgctctga

DBGET integrated database retrieval system