KEGG   Homo sapiens (human): 23403Help
Entry
23403             CDS       T01001                                 

Gene name
FBXO46, 20D7-FC4, FBXO34L, Fbx46
Definition
(RefSeq) F-box protein 46
  KO
K10320  
F-box protein 46
Organism
hsa  Homo sapiens (human)
Brite
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   SCF complex
    Target recognizing subunit (F-box)
     23403 (FBXO46)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
Q6PJ61(Tdark)
UniProt: 
Position
19q13.32
AA seq 603 aa AA seqDB search
MDRGSLLPFQLWCPRPFGTYSQNQPRPPSAALKPSACPEPGGGAEPDHGPAHSENTPPAL
ATEVPASQPAPLLSAAAAGDEGRVLLDTWYVIKPGNTKEKVAFFVAHQCGGGSRASSMKV
KGHWGSDSSKAKRRRRCLDPTKAPPDPGGREGPPAAEEGPASAGEDVDLLSVAEMVALVE
QRAALALQSYPRPTTPAPVVFVSAEQGGPAKGVGSERRSGGGDCSRVAEAVAHFEAQRDS
PPTKGLRKEERPGPGPGEVRIAFRISNGREPRAPDSGLPSGGGGRPGCAYPGSPGPGARA
KDKITCDLYQLISPSRDALPSNVEFLLARADEASEGDSPAPARPEDTPPAPPPPPARDCG
ASGFHVDVVVTGVVDECIFFGKDGTKNVKEETVCLTVSPEEPPPPGQLFFLQNRGPDGPP
EPPPADSPATAPGPDDAEGTADTSLCRLYRHVSHDFLEIRFKIQRLLEPRQYMLLLPEHV
LVKIFSFLPTRALAALKCTCHHFKGIIEAFGVRATDSRWSRDPLYRDDPCKQCRKRYEKG
DVSLCRWHPKPYHHDLPYGRSYWMCCRRADRETPGCRLGLHDNNWVLPCNGPGGGRAGRE
EGR
NT seq 1812 nt NT seq  +upstreamnt  +downstreamnt
atggaccgtgggagcctcctgcccttccagctatggtgcccccggccctttggcacctac
tcacagaaccagccacgcccgccttctgcggccctcaagccatcagcctgccctgagcct
ggtggcggggccgagccagaccatgggcctgcccactcagagaacacaccacccgccttg
gccactgaggtccctgcctcccagccggctccgctcctctcagcagcagctgctggtgat
gagggtcgagtcctcctggacacgtggtatgtcatcaagcccgggaatacaaaggagaag
gtggccttctttgtggcccaccagtgtggtgggggcagccgggccagctccatgaaggtc
aaggggcactggggcagcgatagctccaaggccaagcggcggaggcgctgtcttgacccc
accaaggctcctcctgacccagggggccgggagggcccccctgctgctgaggagggcccc
gcctcagccggtgaggacgtggacctgctctctgtggccgagatggtggccctggtggaa
cagcgggcagccctggccctgcagagctacccacgaccgaccaccccagcgcctgtagtc
tttgtgtccgccgagcaaggtggaccggccaagggggtgggatctgaacggcggtccggt
ggtggggactgcagccgtgtagccgaggccgtggcccactttgaagcgcagagggacagc
cctcccaccaagggcctccgcaaggaagagcggcccgggccaggccctggggaggtgcgc
atcgccttccgcatctccaacggccgggagccccgtgcaccagacagcggcctgcccagt
gggggcgggggcaggcctggttgtgcctaccctggcagcccaggtcctggggcccgagcc
aaggacaagatcacatgtgacttataccagctcatcagcccctcgcgggatgccctcccc
agcaacgtggagttcctgctggccagggcggatgaggccagtgagggtgacagcccggca
cccgccaggcctgaggacactcccccggcgccccctccgccccctgcccgggactgcgga
gcgtcaggcttccacgtggacgtggtggtgacgggcgtggtagatgagtgcatcttcttt
ggcaaggacggcaccaagaacgtgaaggaggagactgtgtgcctgacggtcagcccggag
gaaccgccgcctccgggccagctcttctttctccagaaccgcgggccggacgggcccccg
gagccacccccggccgactccccggccactgcgcccggcccagacgatgccgagggcacg
gcggacacctccctgtgccgcttgtaccggcacgtgtcgcacgacttcctagagatccgc
ttcaagattcagcggctgctggagccgcgacagtacatgctgctgctgcccgagcacgtg
ctggtcaagatcttcagcttcctgcccacgcgcgcgctggccgccctcaagtgcacctgc
caccacttcaagggcatcatcgaggcgtttggcgtgcgggccacagactcgcgctggagc
cgagacccgctctaccgcgatgatccgtgcaaacagtgccgcaagagatacgagaagggc
gacgtgtcgctctgccgctggcaccccaagccctaccaccatgacctgccttacggacgt
tcctactggatgtgctgccgtcgagccgaccgcgagactcccggctgccgcctgggcctc
cacgataacaactgggtgctgccctgcaatgggccaggcgggggccgggccggccgggag
gaggggaggtga

DBGET integrated database retrieval system