KEGG   Homo sapiens (human): 23414Help
Entry
23414             CDS       T01001                                 

Gene name
ZFPM2, DIH3, FOG2, ZC2HC11B, ZNF89B, hFOG-2
Definition
zinc finger protein, FOG family member 2
Orthology
K17442  
zinc finger protein ZFPM2
Organism
hsa  Homo sapiens (human)
Pathway
MicroRNAs in cancer
Disease
H00549  
Tetralogy of Fallot
H01241  
Congenital diaphragmatic hernia (CDH)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Human Diseases
  Cancers
   05206 MicroRNAs in cancer
    23414 (ZFPM2)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  Zinc finger
   Zinc fingers of alternating composition
    23414 (ZFPM2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
8q23
AA seq 1151 aa AA seqDB search
MSRRKQSKPRQIKRPLEDAIEDEEEECPSEETDIISKGDFPLEESFSTEFGPENLSCEEV
EYFCNKGDDEGIQETAESDGDTQSEKPGQPGVETDDWDGPGELEVFQKDGERKIQSRQQL
PVGTTWGPFPGKMDLNNNSLKTKAQVPMVLTAGPKWLLDVTWQGVEDNKNNCIVYSKGGQ
LWCTTTKAISEGEELIAFVVDFDSRLQAASQMTLTEGMYPARLLDSIQLLPQQAAMASIL
PTAIVNKDIFPCKSCGIWYRSERNLQAHLMYYCSGRQREAAPVSEENEDSAHQISSLCPF
PQCTKSFSNARALEMHLNSHSGVKMEEFLPPGASLKCTVCSYTADSVINFHQHLFSHLTQ
AAFRCNHCHFGFQTQRELLQHQELHVPSGKLPRESDMEHSPSATEDSLQPATDLLTRSEL
PQSQKAMQTKDASSDTELDKCEKKTQLFLTNQRPEIQPTTNKQSFSYTKIKSEPSSPRLA
SSPVQPNIGPSFPVGPFLSQFSFPQDITMVPQASEILAKMSELVHRRLRHGSSSYPPVIY
SPLMPKGATCFECNITFNNLDNYLVHKKHYCSSRWQQMAKSPEFPSVSEKMPEALSPNTG
QTSINLLNPAAHSADPENPLLQTSCINSSTVLDLIGPNGKGHDKDFSTQTKKLSTSSNND
DKINGKPVDVKNPSVPLVDGESDPNKTTCEACNITFSRHETYMVHKQYYCATRHDPPLKR
SASNKVPAMQRTMRTRKRRKMYEMCLPEQEQRPPLVQQRFLDVANLNNPCTSTQEPTEGL
GECYHPRCDIFPGIVSKHLETSLTINKCVPVSKCDTTHSSVSCLEMDVPIDLSKKCLSQS
ERTTTSPKRLLDYHECTVCKISFNKVENYLAHKQNFCPVTAHQRNDLGQLDGKVFPNPES
ERNSPDVSYERSIIKCEKNGNLKQPSPNGNLFSSHLATLQGLKVFSEAAQLIATKEENRH
LFLPQCLYPGAIKKAKGADQLSPYYGIKPSDYISGSLVIHNTDIEQSRNAENESPKGQAS
SNGCAALKKDSLPLLPKNRGMVIVNGGLKQDERPAANPQQENISQNPQHEDDHKSPSWIS
ENPLAANENVSPGIPSAEEQLSSIAKGVNGSSQAPTSGKYCRLCDIQFNNLSNFITHKKF
YCSSHAAEHVK
NT seq 3456 nt NT seq  +upstreamnt  +downstreamnt
atgtcccggcgaaagcaaagcaaaccccggcagatcaaacggccgcttgaagatgccatt
gaagatgaggaagaagaatgtccatcagaggaaacagacatcatctccaaaggagacttt
ccattggaggaaagcttttccacagaatttgggcctgaaaatctgagctgcgaagaagtg
gaatacttttgtaacaaaggtgatgatgaaggaatccaggagacagcagaatcagatggg
gacacacagtcagagaaaccggggcaacctggagttgagacagacgactgggatggacca
ggagagctggaggtgtttcagaaagatggggaacgaaaaattcagagtcgacagcaactt
ccagtgggaacaacctgggggccgtttcctgggaagatggacttgaataataattctttg
aagacaaaggctcaggtcccaatggtgctgactgctggtcccaagtggttgctggatgtg
acttggcaaggagtggaagacaacaaaaacaactgcattgtgtacagcaaagggggtcag
ctttggtgtacaactacgaaggccatctctgagggtgaagagctaattgcctttgtggtg
gattttgactcaaggctacaagctgccagtcagatgactctcacagaagggatgtaccct
gcacgcctgctggactcaattcagctgcttcctcagcaagctgccatggcttctattttg
cccacagctattgtcaataaggatatattcccttgcaagtcctgtggcatctggtatcgg
agtgagcggaatctgcaggcccatttgatgtactactgcagtgggaggcaaagagaagct
gctccggtgtcagaggaaaatgaagacagtgcccatcagatttccagcctgtgccccttc
ccacagtgcaccaagagcttttcaaatgctcgagctctagaaatgcacctgaattcacac
agtggagtgaaaatggaagaattcctgccccctggtgctagtctaaaatgcaccgtctgt
agctacactgctgattccgtgatcaactttcaccaacacctgttctcccatctcactcaa
gctgccttccgatgtaatcactgccatttcggcttccagactcagagggagttattgcag
caccaggagctccatgtccctagcggcaaacttcccagagaaagtgacatggaacactct
ccaagtgcaactgaagacagcttacagccagccacagacttattgaccagaagcgaactt
ccccagagccaaaaggccatgcagactaaagatgcgagctctgacacagagctggacaag
tgtgagaaaaagactcagctctttctcacgaaccagagaccagagatacagcctacaaca
aataaacaaagcttttcttacacaaaaataaagtctgagccctctagcccaagacttgcc
tcatctccagttcagcctaatattgggccttctttccctgtgggccctttcctatctcag
ttttctttcccccaagatatcaccatggtccctcaagcttcagagatcttagctaagatg
tctgaactggtgcatcggcgactgaggcatggcagtagtagctaccctcccgtcatttac
agccctttgatgcccaagggggctacttgttttgagtgtaacataacattcaataatttg
gataattatctagtgcacaaaaagcattattgcagcagccgatggcagcagatggctaag
tccccagagttccctagtgtgtcagaaaagatgcctgaagctttgagtcccaacactggc
caaacctccataaaccttctcaacccagctgctcattctgctgatcctgagaatccactt
cttcaaacatcttgcatcaattcttccactgtcttagatttaattgggccaaatgggaag
ggccatgacaaggacttttccactcaaactaagaagctctccacctccagtaacaatgat
gacaaaattaatggaaaacctgttgatgtgaaaaatcccagtgtccccttagtggatggg
gaaagtgacccaaataagactacctgtgaagcttgcaacattaccttcagccggcacgaa
acatacatggtccacaaacagtattactgtgctacacgccacgaccctccactgaagagg
tctgcttccaacaaagtgcctgccatgcagagaaccatgcgcacacgcaagcgcagaaag
atgtatgagatgtgcctacctgagcaggaacaaaggcctccactggttcagcagagattt
cttgacgtagccaacctcaataatccttgtacctccactcaagaacccacagaagggcta
ggagagtgctaccacccaagatgtgatatctttccaggaattgtctctaaacacttggaa
acttctctgacgatcaacaagtgtgttccagtttccaaatgtgatactactcattccagt
gtttcctgcctagagatggacgtgcccatagatctcagcaaaaagtgtttatctcagtct
gagcggacgaccacgtctcccaaaaggctgctggactatcacgagtgcactgtgtgcaag
atcagtttcaataaggtagaaaactatctggcccacaagcagaatttctgcccggttact
gcacatcagcgtaatgacctgggtcaactggacggcaaagtgtttccgaatccagaaagc
gaacgaaacagccctgatgtcagctacgaaagaagcataataaaatgtgagaaaaatggg
aatttgaagcagccttcccccaatggaaacttattttcatcccacctagcaaccctgcaa
ggcttgaaggtctttagtgaagctgctcagctcattgctacaaaagaagaaaacagacat
ttgtttcttccacaatgcctttaccctggagcaataaagaaagcaaaaggagccgaccag
ctttctccatattatggaatcaagccaagtgattatatttctggttctcttgtcatccat
aacactgacatcgagcaaagcagaaatgcagaaaatgaatctcctaaaggccaggcttcc
tcaaatgggtgtgctgcgctgaagaaagattctctgccattgttgcccaaaaatcgagga
atggtaatagtgaatggtggactgaaacaagatgagagacctgctgccaacccacagcaa
gagaacatttcccagaatcctcagcacgaagacgaccacaaatctccctcgtggatctct
gagaacccattagctgccaatgagaatgtctcaccaggaattccctcagcagaggaacag
ttgtctagtatagcaaaaggtgtgaatggttccagccaggctccaaccagtgggaaatat
tgccggctatgtgatatccagttcaacaacctttcaaactttataactcacaagaagttt
tattgctcatcacatgcagcagaacatgtcaaatga

DBGET integrated database retrieval system