KEGG   Homo sapiens (human): 23417Help
Entry
23417             CDS       T01001                                 

Gene name
MLYCD, MCD
Definition
malonyl-CoA decarboxylase (EC:4.1.1.9)
Orthology
K01578  
malonyl-CoA decarboxylase [EC:4.1.1.9]
Organism
hsa  Homo sapiens (human)
Pathway
beta-Alanine metabolism
Propanoate metabolism
Metabolic pathways
Peroxisome
AMPK signaling pathway
Disease
H01283  
Malonyl-CoA decarboxylase deficiency
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    23417 (MLYCD)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    23417 (MLYCD)
 Environmental Information Processing
  Signal transduction
   04152 AMPK signaling pathway
    23417 (MLYCD)
 Cellular Processes
  Transport and catabolism
   04146 Peroxisome
    23417 (MLYCD)
Enzymes [BR:hsa01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.9  malonyl-CoA decarboxylase
     23417 (MLYCD)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
16q24
AA seq 493 aa AA seqDB search
MRGFGPGLTARRLLPLRLPPRPPGPRLASGQAAGALERAMDELLRRAVPPTPAYELREKT
PAPAEGQCADFVSFYGGLAETAQRAELLGRLARGFGVDHGQVAEQSAGVLHLRQQQREAA
VLLQAEDRLRYALVPRYRGLFHHISKLDGGVRFLVQLRADLLEAQALKLVEGPDVREMNG
VLKGMLSEWFSSGFLNLERVTWHSPCEVLQKISEAEAVHPVKNWMDMKRRVGPYRRCYFF
SHCSTPGEPLVVLHVALTGDISSNIQAIVKEHPPSETEEKNKITAAIFYSISLTQQGLQG
VELGTFLIKRVVKELQREFPHLGVFSSLSPIPGFTKWLLGLLNSQTKEHGRNELFTDSEC
KEISEITGGPINETLKLLLSSSEWVQSEKLVRALQTPLMRLCAWYLYGEKHRGYALNPVA
NFHLQNGAVLWRINWMADVSLRGITGSCGLMANYRYFLEETGPNSTSYLGSKIIKASEQV
LSLVAQFQKNSKL
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
atgcgaggcttcgggccaggcttgacggccaggcgtctcctcccgctgcggttgcccccg
cggccgcccgggccccggctggcgagcgggcaggcggccggcgccctggagcgggccatg
gacgagctgctgcgccgcgcggtgccgccgacgccggcctacgagctgcgcgagaagaca
ccggcgcccgccgagggtcagtgcgcggacttcgtgagcttctacggtgggctggccgag
acggcccagcgggccgaactgctgggccgcctggcgcggggcttcggcgtggaccacggc
caggtggcggagcagagcgccggcgtgctccatctgcgccagcagcagcgggaggcggcg
gtgctgctgcaggccgaggaccggctgcgctacgcgctggtgccgcgctatcgcggcctc
ttccaccacatcagcaagctggacggcggcgtgcgcttcctggtgcagctgcgggccgac
ctgctggaggcgcaggccctcaagctggtggaggggccggacgtccgggaaatgaatggg
gtgctgaaaggaatgctctcagaatggttttcctccgggttcctgaacctagaacgggtt
acctggcattcaccgtgtgaagtgcttcagaaaatcagtgaggctgaggctgtgcatcct
gtaaaaaactggatggacatgaagcgccgcgttgggccctacagaaggtgttacttcttt
tctcactgttcgacccctggggagcccctggtcgttttgcacgtggcactgactggtgac
atctccagcaacatccaggcaatcgtgaaggaacatcctccatcagaaacagaagagaag
aacaaaatcactgctgcgatcttttattccatcagcttgacccagcagggactccaaggg
gtggagctgggaacattcctcataaagcgagtcgtcaaggagttgcagagagagtttcct
caccttggggtgttttcaagtctgtcacctatacctggtttcaccaaatggcttctgggg
cttctgaactcgcaaacgaaggagcatgggaggaatgaactctttacagattcggaatgt
aaggaaatctcggagatcacaggtggccccattaacgagaccctcaagctcctcctcagc
agcagcgagtgggtgcagtcggagaagctggtgcgggcgctgcagactccgctgatgagg
ctgtgcgcctggtacctgtatggagagaagcaccgcggctacgcgctgaaccccgtggcc
aacttccacctgcagaacggggcggtgctgtggcgcatcaactggatggcggatgtgagc
ctcagaggcatcaccggctcctgcggcctgatggccaactaccgctacttcctggaggag
acgggccccaacagcacctcctacctcggctccaagatcatcaaagcctctgagcaggtc
ctcagcctagtggcccagtttcaaaagaacagcaagctctga

DBGET integrated database retrieval system