KEGG   Homo sapiens (human): 2342Help
Entry
2342              CDS       T01001                                 

Gene name
FNTB, FPTB
Definition
(RefSeq) farnesyltransferase, CAAX box, beta (EC:2.5.1.58)
  KO
K05954  
protein farnesyltransferase subunit beta [EC:2.5.1.58]
Organism
hsa  Homo sapiens (human)
Pathway
Terpenoid backbone biosynthesis
Drug target
Lonafarnib: 
Tipifarnib: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    2342 (FNTB)
Enzymes [BR:hsa01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.58  protein farnesyltransferase
     2342 (FNTB)
Prenyltransferases [BR:hsa01006]
 Protein prenylation
  Farnesyltransferase/geranylgeranyltransferase 1
   2342 (FNTB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
UniProt: 
Structure
PDB: 

Jmol
Position
14q23.3
AA seq 437 aa AA seqDB search
MASPSSFTYYCPPSSSPVWSEPLYSLRPEHARERLQDDSVETVTSIEQAKVEEKIQEVFS
SYKFNHLVPRLVLQREKHFHYLKRGLRQLTDAYECLDASRPWLCYWILHSLELLDEPIPQ
IVATDVCQFLELCQSPEGGFGGGPGQYPHLAPTYAAVNALCIIGTEEAYDIINREKLLQY
LYSLKQPDGSFLMHVGGEVDVRSAYCAASVASLTNIITPDLFEGTAEWIARCQNWEGGIG
GVPGMEAHGGYTFCGLAALVILKRERSLNLKSLLQWVTSRQMRFEGGFQGRCNKLVDGCY
SFWQAGLLPLLHRALHAQGDPALSMSHWMFHQQALQEYILMCCQCPAGGLLDKPGKSRDF
YHTCYCLSGLSIAQHFGSGAMLHDVVLGVPENALQPTHPVYNIGPDKVIQATTYFLQKPV
PGFEELKDETSAEPATD
NT seq 1314 nt NT seq  +upstreamnt  +downstreamnt
atggcttctccgagttctttcacctactattgccctccatcttcctcccccgtctggtca
gagccgctgtacagtctgaggcccgagcacgcgcgagagcggttgcaggacgactcggtg
gaaacagtcacgtccatagaacaggcaaaagtagaagaaaagatccaagaggtcttcagt
tcttacaagttcaaccaccttgtaccaaggcttgttttgcagagggagaagcacttccat
tatctgaaaagaggccttcgacaactgacagatgcctatgagtgtctggatgccagccgc
ccatggctctgctattggatcctgcacagcttggaactgctagatgaacccatcccccag
atagtggctacagatgtgtgtcagttcctggagctgtgtcagagcccagaaggtggcttt
ggaggaggacccggtcagtatccacaccttgcacccacatatgcagcagtcaatgcattg
tgcatcattggcaccgaggaggcctatgacatcattaacagagagaagcttcttcagtat
ttgtactccctgaagcaacctgacggctcctttctcatgcatgtcggaggtgaggtggat
gtgagaagcgcatactgtgctgcctccgtagcctcgctgaccaacatcatcactccagac
ctctttgagggcactgctgaatggatagcaaggtgtcagaactgggaaggtggcattggc
ggggtaccagggatggaagcccatggtggctataccttctgtggcctggccgcgctggta
atcctcaagagggaacgttccttgaacttgaagagcttattacaatgggtgacaagccgg
cagatgcgatttgaaggaggatttcagggccgctgcaacaagctggtggatggctgctac
tccttctggcaggcggggctcctgcccctgctccaccgcgcactgcacgcccaaggtgac
cctgcccttagcatgagccactggatgttccatcagcaggccctgcaggagtacatcctg
atgtgctgccagtgccctgcgggggggcttctggataaacctggcaagtcgcgtgatttc
taccacacctgctactgcctgagcggcctgtccatagcccagcacttcggcagcggagcc
atgttgcatgatgtggtcctgggtgtgcccgaaaacgctctgcagcccactcacccagtg
tacaacattggaccagacaaggtgatccaggccactacatactttctacagaagccagtc
ccaggttttgaggagcttaaggatgagacatcggcagagcctgcaaccgactag

DBGET integrated database retrieval system