KEGG   Homo sapiens (human): 23428Help
Entry
23428             CDS       T01001                                 

Gene name
SLC7A8, LAT2, LPI-PC1
Definition
(RefSeq) solute carrier family 7 member 8
  KO
K13781  
solute carrier family 7 (L-type amino acid transporter), member 8
Organism
hsa  Homo sapiens (human)
Pathway
Protein digestion and absorption
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Digestive system
   04974 Protein digestion and absorption
    23428 (SLC7A8)
Transporters [BR:hsa02000]
 Solute Carrier Family (SLC)
  SLC7: Cationic amino acid transporter/glycoprotein-associated
   23428 (SLC7A8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
14q11.2
AA seq 535 aa AA seqDB search
MEEGARHRNNTEKKHPGGGESDASPEAGSGGGGVALKKEIGLVSACGIIVGNIIGSGIFV
SPKGVLENAGSVGLALIVWIVTGFITVVGALCYAELGVTIPKSGGDYSYVKDIFGGLAGF
LRLWIAVLVIYPTNQAVIALTFSNYVLQPLFPTCFPPESGLRLLAAICLLLLTWVNCSSV
RWATRVQDIFTAGKLLALALIIIMGIVQICKGEYFWLEPKNAFENFQEPDIGLVALAFLQ
GSFAYGGWNFLNYVTEELVDPYKNLPRAIFISIPLVTFVYVFANVAYVTAMSPQELLASN
AVAVTFGEKLLGVMAWIMPISVALSTFGGVNGSLFTSSRLFFAGAREGHLPSVLAMIHVK
RCTPIPALLFTCISTLLMLVTSDMYTLINYVGFINYLFYGVTVAGQIVLRWKKPDIPRPI
KINLLFPIIYLLFWAFLLVFSLWSEPVVCGIGLAIMLTGVPVYFLGVYWQHKPKCFSDFI
ELLTLVSQKMCVVVYPEVERGSGTEEANEDMEEQQQPMYQPTPTKDKDVAGQPQP
NT seq 1608 nt NT seq  +upstreamnt  +downstreamnt
atggaagaaggagccaggcaccgaaacaacaccgaaaagaaacacccaggtgggggcgag
tcggacgccagccccgaggctggttccggagggggcggagtagccctgaagaaagagatc
ggattggtcagtgcctgtggtatcatcgtagggaacatcatcggctctggaatctttgtc
tcgccaaagggagtgctggagaatgctggttctgtgggccttgctctcatcgtctggatt
gtgacgggcttcatcacagttgtgggagccctctgctatgctgaactcggggtcaccatc
cccaaatctggaggtgactactcctatgtcaaggacatcttcggaggactggctgggttc
ctgaggctgtggattgctgtgctggtgatctaccccaccaaccaggctgtcatcgccctc
accttctccaactacgtgctgcagccgctcttccccacctgcttccccccagagtctggc
cttcggctcctggctgccatctgcttattgctcctcacatgggtcaactgttccagtgtg
cggtgggccacccgggttcaagacatcttcacagctgggaagctcctggccttggccctg
attatcatcatggggattgtacagatatgcaaaggagagtacttctggctggagccaaag
aatgcatttgagaatttccaggaacctgacatcggcctcgtcgcactggctttccttcag
ggctcctttgcctatggaggctggaactttctgaattacgtgactgaggagcttgttgat
ccctacaagaaccttcccagagccatcttcatctccatcccactggtcacatttgtgtat
gtctttgccaatgtcgcttatgtcactgcaatgtccccccaggagctgctggcatccaac
gccgtcgctgtgacttttggagagaagctcctaggagtcatggcctggatcatgcccatt
tctgttgccctgtccacatttggaggagttaatgggtctctcttcacctcctctcggctg
ttcttcgctggagcccgagagggccaccttcccagtgtgttggccatgatccacgtgaag
cgctgcaccccaatcccagccctgctcttcacatgcatctccaccctgctgatgctggtc
accagcgacatgtacacactcatcaactatgtgggcttcatcaactacctcttctatggg
gtcacggttgctggacagatagtccttcgctggaagaagcctgatatcccccgccccatc
aagatcaacctgctgttccccatcatctacttgctgttctgggccttcctgctggtcttc
agcctgtggtcagagccggtggtgtgtggcattggcctggccatcatgctgacaggagtg
cctgtctatttcctgggtgtttactggcaacacaagcccaagtgtttcagtgacttcatt
gagctgctaaccctggtgagccagaagatgtgtgtggtcgtgtaccccgaggtggagcgg
ggctcagggacagaggaggctaatgaggacatggaggagcagcagcagcccatgtaccaa
cccactcccacgaaggacaaggacgtggcggggcagccccagccctga

DBGET integrated database retrieval system