KEGG   Homo sapiens (human): 23428Help
Entry
23428             CDS       T01001                                 

Gene name
SLC7A8, LAT2, LPI-PC1
Definition
solute carrier family 7 (amino acid transporter light chain, L system), member 8
Orthology
K13781  
solute carrier family 7 (L-type amino acid transporter), member 8
Organism
hsa  Homo sapiens (human)
Pathway
Protein digestion and absorption
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Digestive system
   04974 Protein digestion and absorption
    23428 (SLC7A8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
14q11.2
AA seq 430 aa AA seqDB search
MGQYGQELSWKCLVKAVCLQEHSQPSQLLCTLLLCWCVLGRERPFRKAQSTSSPLEGVPR
FLKRLLLTWVNCSSVRWATRVQDIFTAGKLLALALIIIMGIVQICKGEYFWLEPKNAFEN
FQEPDIGLVALAFLQGSFAYGGWNFLNYVTEELVDPYKNLPRAIFISIPLVTFVYVFANV
AYVTAMSPQELLASNAVAVTFGEKLLGVMAWIMPISVALSTFGGVNGSLFTSSRLFFAGA
REGHLPSVLAMIHVKRCTPIPALLFTCISTLLMLVTSDMYTLINYVGFINYLFYGVTVAG
QIVLRWKKPDIPRPIKINLLFPIIYLLFWAFLLVFSLWSEPVVCGIGLAIMLTGVPVYFL
GVYWQHKPKCFSDFIELLTLVSQKMCVVVYPEVERGSGTEEANEDMEEQQQPMYQPTPTK
DKDVAGQPQP
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
atggggcagtatgggcaggagcttagctggaagtgtttggtaaaagctgtgtgcctccag
gagcactcacagccctcacagcttctctgcaccctcctcctctgctggtgtgtccttgga
agagagaggcccttccggaaggctcagagcacctcctctcctttggagggggttccgaga
tttctaaaacgtttgctcctcacatgggtcaactgttccagtgtgcggtgggccacccgg
gttcaagacatcttcacagctgggaagctcctggccttggccctgattatcatcatgggg
attgtacagatatgcaaaggagagtacttctggctggagccaaagaatgcatttgagaat
ttccaggaacctgacatcggcctcgtcgcactggctttccttcagggctcctttgcctat
ggaggctggaactttctgaattacgtgactgaggagcttgttgatccctacaagaacctt
cccagagccatcttcatctccatcccactggtcacatttgtgtatgtctttgccaatgtc
gcttatgtcactgcaatgtccccccaggagctgctggcatccaacgccgtcgctgtgact
tttggagagaagctcctaggagtcatggcctggatcatgcccatttctgttgccctgtcc
acatttggaggagttaatgggtctctcttcacctcctctcggctgttcttcgctggagcc
cgagagggccaccttcccagtgtgttggccatgatccacgtgaagcgctgcaccccaatc
ccagccctgctcttcacatgcatctccaccctgctgatgctggtcaccagcgacatgtac
acactcatcaactatgtgggcttcatcaactacctcttctatggggtcacggttgctgga
cagatagtccttcgctggaagaagcctgatatcccccgccccatcaagatcaacctgctg
ttccccatcatctacttgctgttctgggccttcctgctggtcttcagcctgtggtcagag
ccggtggtgtgtggcattggcctggccatcatgctgacaggagtgcctgtctatttcctg
ggtgtttactggcaacacaagcccaagtgtttcagtgacttcattgagctgctaaccctg
gtgagccagaagatgtgtgtggtcgtgtaccccgaggtggagcggggctcagggacagag
gaggctaatgaggacatggaggagcagcagcagcccatgtaccaacccactcccacgaag
gacaaggacgtggcggggcagccccagccctga

DBGET integrated database retrieval system