KEGG   Homo sapiens (human): 23433Help
Entry
23433             CDS       T01001                                 

Gene name
RHOQ, ARHQ, HEL-S-42, RASL7A, TC10, TC10A
Definition
ras homolog family member Q
Orthology
K07194  
Ras homolog gene family, member Q
Organism
hsa  Homo sapiens (human)
Pathway
Insulin signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    23433 (RHOQ)
GTP-binding proteins [BR:hsa04031]
 Small (Monomeric) G-proteins
  Rho Family
   Rac/Cdc42 [OT]
    23433 (RHOQ)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
UniProt: 
Structure
PDB: 

Jmol
Position
2p21
AA seq 205 aa AA seqDB search
MAHGPGALMLKCVVVGDGAVGKTCLLMSYANDAFPEEYVPTVFDHYAVSVTVGGKQYLLG
LYDTAGQEDYDRLRPLSYPMTDVFLICFSVVNPASFQNVKEEWVPELKEYAPNVPFLLIG
TQIDLRDDPKTLARLNDMKEKPICVEQGQKLAKEIGACCYVECSALTQKGLKTVFDEAII
AILTPKKHTVKKRIGSRCINCCLIT
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atggctcacgggcccggcgcgctgatgctcaagtgcgtggtggtcggcgacggggcggtg
ggcaagacgtgcctactcatgagctatgccaacgacgccttcccggaggagtacgtgccc
accgtcttcgaccactacgcagtcagcgtcaccgtggggggcaagcagtacctcctagga
ctctatgacacggccggacaggaagactatgaccgtctgaggcctttatcttacccaatg
accgatgtcttccttatatgcttctcggtggtaaatccagcctcatttcaaaatgtgaaa
gaggagtgggtaccggaacttaaggaatacgcaccaaatgtaccctttttattaatagga
actcagattgatctccgagatgaccccaaaactttagcaagactgaatgatatgaaagaa
aaacctatatgtgtggaacaaggacagaaactagcaaaagagataggagcatgctgctat
gtggaatgttcagctttaacccagaagggattgaagactgtttttgatgaggctatcata
gccattttaactccaaagaaacacactgtaaaaaaaagaataggatcaagatgtataaac
tgttgtttaattacgtga

DBGET integrated database retrieval system