KEGG   Homo sapiens (human): 23435Help
Entry
23435             CDS       T01001                                 

Gene name
TARDBP, ALS10, TDP-43
Definition
(RefSeq) TAR DNA binding protein
Organism
hsa  Homo sapiens (human)
Disease
H00058  
Amyotrophic lateral sclerosis (ALS)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
UniProt: 
Structure
PDB: 

Jmol
Position
1p36.22
AA seq 414 aa AA seqDB search
MSEYIRVTEDENDEPIEIPSEDDGTVLLSTVTAQFPGACGLRYRNPVSQCMRGVRLVEGI
LHAPDAGWGNLVYVVNYPKDNKRKMDETDASSAVKVKRAVQKTSDLIVLGLPWKTTEQDL
KEYFSTFGEVLMVQVKKDLKTGHSKGFGFVRFTEYETQVKVMSQRHMIDGRWCDCKLPNS
KQSQDEPLRSRKVFVGRCTEDMTEDELREFFSQYGDVMDVFIPKPFRAFAFVTFADDQIA
QSLCGEDLIIKGISVHISNAEPKHNSNRQLERSGRFGGNPGGFGNQGGFGNSRGGGAGLG
NNQGSNMGGGMNFGAFSINPAMMAAAQAALQSSWGMMGMLASQQNQSGPSGNNQNQGNMQ
REPNQAFGSGNNSYSGSNSGAAIGWGSASNAGSGSGFNGGFGSSMDSKSSGWGM
NT seq 1245 nt NT seq  +upstreamnt  +downstreamnt
atgtctgaatatattcgggtaaccgaagatgagaacgatgagcccattgaaataccatcg
gaagacgatgggacggtgctgctctccacggttacagcccagtttccaggggcgtgtggg
cttcgctacaggaatccagtgtctcagtgtatgagaggtgtccggctggtagaaggaatt
ctgcatgccccagatgctggctggggaaatctggtgtatgttgtcaactatccaaaagat
aacaaaagaaaaatggatgagacagatgcttcatcagcagtgaaagtgaaaagagcagtc
cagaaaacatccgatttaatagtgttgggtctcccatggaaaacaaccgaacaggacctg
aaagagtattttagtacctttggagaagttcttatggtgcaggtcaagaaagatcttaag
actggtcattcaaaggggtttggctttgttcgttttacggaatatgaaacacaagtgaaa
gtaatgtcacagcgacatatgatagatggacgatggtgtgactgcaaacttcctaattct
aagcaaagccaagatgagcctttgagaagcagaaaagtgtttgtggggcgctgtacagag
gacatgactgaggatgagctgcgggagttcttctctcagtacggggatgtgatggatgtc
ttcatccccaagccattcagggcctttgcctttgttacatttgcagatgatcagattgcg
cagtctctttgtggagaggacttgatcattaaaggaatcagcgttcatatatccaatgcc
gaacctaagcacaatagcaatagacagttagaaagaagtggaagatttggtggtaatcca
ggtggctttgggaatcagggtggatttggtaatagcagagggggtggagctggtttggga
aacaatcaaggtagtaatatgggtggtgggatgaactttggtgcgttcagcattaatcca
gccatgatggctgccgcccaggcagcactacagagcagttggggtatgatgggcatgtta
gccagccagcagaaccagtcaggcccatcgggtaataaccaaaaccaaggcaacatgcag
agggagccaaaccaggccttcggttctggaaataactcttatagtggctctaattctggt
gcagcaattggttggggatcagcatccaatgcagggtcgggcagtggttttaatggaggc
tttggctcaagcatggattctaagtcttctggctggggaatgtag

DBGET integrated database retrieval system