KEGG   Homo sapiens (human): 23451Help
Entry
23451             CDS       T01001                                 

Gene name
SF3B1, Hsh155, MDS, PRP10, PRPF10, SAP155, SF3b155
Definition
splicing factor 3b, subunit 1, 155kDa
Orthology
K12828  
splicing factor 3B subunit 1
Organism
hsa  Homo sapiens (human)
Pathway
Spliceosome
Module
Spliceosome, U2-snRNP
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Transcription
   03040 Spliceosome
    23451 (SF3B1)
Spliceosome [BR:hsa03041]
 Complex A
  U2 snRNP components
   U2 snRNP specific factors
    23451 (SF3B1)
 Complex B
    23451 (SF3B1)
 Complex C
   U2 SnRNP specific factors
    23451 (SF3B1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
2q33.1
AA seq 144 aa AA seqDB search
MAKIAKTHEDIEAQIREIQGKKAALDEAQGVGLDSTGYYDQEIYGGSDSRFAGYVTSIAA
TELEDDDDDYSSSTSLLGQKKPGYHAPVALLNDIPQSTEQYDPFAEHRPPKIADREDEYK
KHRRTMIISPERLDPFADGFYSAA
NT seq 435 nt NT seq  +upstreamnt  +downstreamnt
atggcgaagatcgccaagactcacgaagatattgaagcacagattcgagaaattcaaggc
aagaaggcagctcttgatgaagctcaaggagtgggcctcgattctacaggttattatgac
caggaaatttatggtggaagtgacagcagatttgctggatacgtgacatcaattgctgca
actgaacttgaagatgatgacgatgactattcatcatctacgagtttgcttggtcagaag
aagccaggatatcatgcccctgtggcattgcttaatgatataccacagtcaacagaacag
tatgatccatttgctgagcacagacctccaaagattgcagaccgggaagatgaatacaaa
aagcataggcggaccatgataatttccccagagcgtcttgatccttttgcagatggcttc
tattctgctgcttga

DBGET integrated database retrieval system