KEGG   Homo sapiens (human): 23451Help
Entry
23451             CDS       T01001                                 

Gene name
SF3B1, Hsh155, MDS, PRP10, PRPF10, SAP155, SF3b155
Definition
(RefSeq) splicing factor 3b subunit 1
  KO
K12828  splicing factor 3B subunit 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa03040  Spliceosome
Module
hsa_M00352  Spliceosome, U2-snRNP
Disease
H01481  Myelodysplastic syndrome (MDS)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Transcription
   03040 Spliceosome
    23451 (SF3B1)
Spliceosome [BR:hsa03041]
 Complex A
  U2 snRNP components
   U2 snRNP specific factors
    23451 (SF3B1)
 Complex B
    23451 (SF3B1)
 Complex C
   U2 SnRNP specific factors
    23451 (SF3B1)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic Type
  Chromatin remodeling factors
   B-WICH complex
    23451 (SF3B1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SF3b1 HEAT HEAT_2 Adaptin_N UNC45-central
Motif
Other DBs
NCBI-GeneID: 23451
NCBI-ProteinID: NP_036565
OMIM: 605590
HGNC: 10768
Ensembl: ENSG00000115524
Vega: OTTHUMG00000154447
Pharos: O75533(Tbio)
UniProt: O75533 B4DGZ4
Structure
PDB: 

Jmol
Position
2q33.1
AA seq 1304 aa AA seqDB search
MAKIAKTHEDIEAQIREIQGKKAALDEAQGVGLDSTGYYDQEIYGGSDSRFAGYVTSIAA
TELEDDDDDYSSSTSLLGQKKPGYHAPVALLNDIPQSTEQYDPFAEHRPPKIADREDEYK
KHRRTMIISPERLDPFADGGKTPDPKMNARTYMDVMREQHLTKEEREIRQQLAEKAKAGE
LKVVNGAAASQPPSKRKRRWDQTADQTPGATPKKLSSWDQAETPGHTPSLRWDETPGRAK
GSETPGATPGSKIWDPTPSHTPAGAATPGRGDTPGHATPGHGGATSSARKNRWDETPKTE
RDTPGHGSGWAETPRTDRGGDSIGETPTPGASKRKSRWDETPASQMGGSTPVLTPGKTPI
GTPAMNMATPTPGHIMSMTPEQLQAWRWEREIDERNRPLSDEELDAMFPEGYKVLPPPAG
YVPIRTPARKLTATPTPLGGMTGFHMQTEDRTMKSVNDQPSGNLPFLKPDDIQYFDKLLV
DVDESTLSPEEQKERKIMKLLLKIKNGTPPMRKAALRQITDKAREFGAGPLFNQILPLLM
SPTLEDQERHLLVKVIDRILYKLDDLVRPYVHKILVVIEPLLIDEDYYARVEGREIISNL
AKAAGLATMISTMRPDIDNMDEYVRNTTARAFAVVASALGIPSLLPFLKAVCKSKKSWQA
RHTGIKIVQQIAILMGCAILPHLRSLVEIIEHGLVDEQQKVRTISALAIAALAEAATPYG
IESFDSVLKPLWKGIRQHRGKGLAAFLKAIGYLIPLMDAEYANYYTREVMLILIREFQSP
DEEMKKIVLKVVKQCCGTDGVEANYIKTEILPPFFKHFWQHRMALDRRNYRQLVDTTVEL
ANKVGAAEIISRIVDDLKDEAEQYRKMVMETIEKIMGNLGAADIDHKLEEQLIDGILYAF
QEQTTEDSVMLNGFGTVVNALGKRVKPYLPQICGTVLWRLNNKSAKVRQQAADLISRTAV
VMKTCQEEKLMGHLGVVLYEYLGEEYPEVLGSILGALKAIVNVIGMHKMTPPIKDLLPRL
TPILKNRHEKVQENCIDLVGRIADRGAEYVSAREWMRICFELLELLKAHKKAIRRATVNT
FGYIAKAIGPHDVLATLLNNLKVQERQNRVCTTVAIAIVAETCSPFTVLPALMNEYRVPE
LNVQNGVLKSLSFLFEYIGEMGKDYIYAVTPLLEDALMDRDLVHRQTASAVVQHMSLGVY
GFGCEDSLNHLLNYVWPNVFETSPHVIQAVMGALEGLRVAIGPCRMLQYCLQGLFHPARK
VRDVYWKIYNSIYIGSQDALIAHYPRIYNDDKNTYIRYELDYIL
NT seq 3915 nt NT seq  +upstreamnt  +downstreamnt
atggcgaagatcgccaagactcacgaagatattgaagcacagattcgagaaattcaaggc
aagaaggcagctcttgatgaagctcaaggagtgggcctcgattctacaggttattatgac
caggaaatttatggtggaagtgacagcagatttgctggatacgtgacatcaattgctgca
actgaacttgaagatgatgacgatgactattcatcatctacgagtttgcttggtcagaag
aagccaggatatcatgcccctgtggcattgcttaatgatataccacagtcaacagaacag
tatgatccatttgctgagcacagacctccaaagattgcagaccgggaagatgaatacaaa
aagcataggcggaccatgataatttccccagagcgtcttgatccttttgcagatggaggg
aaaacccctgatcctaaaatgaatgctaggacttacatggatgtaatgcgagaacaacac
ttgactaaagaagaacgagaaattaggcaacagctagcagaaaaagctaaagctggagaa
ctaaaagtcgtcaatggagcagcagcgtcccagcctccatcaaaacgaaaacggcgttgg
gatcaaacagctgatcagactcctggtgccactcccaaaaaactatcaagttgggatcag
gcagagacccctgggcatactccttccttaagatgggatgagacaccaggtcgtgcaaag
ggaagcgagactcctggagcaaccccaggctcaaaaatatgggatcctacacctagccac
acaccagcgggagctgctactcctggacgaggtgatacaccaggccatgcgacaccaggc
catggaggcgcaacttccagtgctcgtaaaaacagatgggatgaaacccccaaaacagag
agagatactcctgggcatggaagtggatgggctgagactcctcgaacagatcgaggtgga
gattctattggtgaaacaccgactcctggagccagtaaaagaaaatcacggtgggatgaa
acaccagctagtcagatgggtggaagcactccagttctgacccctggaaagacaccaatt
ggcacaccagccatgaacatggctacccctactccaggtcacataatgagtatgactcct
gaacagcttcaggcttggcggtgggaaagagaaattgatgagagaaatcgcccactttct
gatgaggaattagatgctatgttcccagaaggatataaggtacttcctcctccagctggt
tatgttcctattcgaactccagctcgaaagctgacagctactccaacacctttgggtggt
atgactggtttccacatgcaaactgaagatcgaactatgaaaagtgttaatgaccagcca
tctggaaatcttccatttttaaaacctgatgatattcaatactttgataaactattggtt
gatgttgatgaatcaacacttagtccagaagagcaaaaagagagaaaaataatgaagttg
cttttaaaaattaagaatggaacaccaccaatgagaaaggctgcattgcgtcagattact
gataaagctcgtgaatttggagctggtcctttgtttaatcagattcttcctctgctgatg
tctcctacacttgaggatcaagagcgtcatttacttgtgaaagttattgataggatactg
tacaaacttgatgacttagttcgtccatatgtgcataagatcctcgtggtcattgaaccg
ctattgattgatgaagattactatgctagagtggaaggccgagagatcatttctaatttg
gcaaaggctgctggtctggctactatgatctctaccatgagacctgatatagataacatg
gatgagtatgtccgtaacacaacagctagagcttttgctgttgtagcctctgccctgggc
attccttctttattgcccttcttaaaagctgtgtgcaaaagcaagaagtcctggcaagcg
agacacactggtattaagattgtacaacagatagctattcttatgggctgtgccatcttg
ccacatcttagaagtttagttgaaatcattgaacatggtcttgtggatgagcagcagaaa
gttcggaccatcagtgctttggccattgctgccttggctgaagcagcaactccttatggt
atcgaatcttttgattctgtgttaaagcctttatggaagggtatccgccaacacagagga
aagggtttggctgctttcttgaaggctattgggtatcttattcctcttatggatgcagaa
tatgccaactactatactagagaagtgatgttaatccttattcgagaattccagtctcct
gatgaggaaatgaaaaaaattgtgctgaaggtggtaaaacagtgttgtgggacagatggt
gtagaagcaaactacattaaaacagagattcttcctcccttttttaaacacttctggcag
cacaggatggctttggatagaagaaattaccgacagttagttgatactactgtggagttg
gcaaacaaagtaggtgcagcagaaattatatccaggattgtggatgatctgaaagatgaa
gccgaacagtacagaaaaatggtgatggagacaattgagaaaattatgggtaatttggga
gcagcagatattgatcataaacttgaagaacaactgattgatggtattctttatgctttc
caagaacagactacagaggactcagtaatgttgaacggctttggcacagtggttaatgct
cttggcaaacgagtcaaaccatacttgcctcagatctgtggtacagttttgtggcgttta
aataacaaatctgctaaagttaggcaacaggcagctgacttgatttctcgaactgctgtt
gtcatgaagacttgtcaagaggaaaaattgatgggacacttgggtgttgtattgtatgag
tatttgggtgaagagtaccctgaagtattgggcagcattcttggagcactgaaggccatt
gtaaatgtcataggtatgcataagatgactccaccaattaaagatctgctgcctagactc
acccccatcttaaagaacagacatgaaaaagtacaagagaattgtattgatcttgttggt
cgtattgctgacaggggagctgaatatgtatctgcaagagagtggatgaggatttgcttt
gagcttttagagctcttaaaagcccacaaaaaggctattcgtagagccacagtcaacaca
tttggttatattgcaaaggccattggccctcatgatgtattggctacacttctgaacaac
ctcaaagttcaagaaaggcagaacagagtttgtaccactgtagcaatagctattgttgca
gaaacatgttcaccctttacagtactccctgccttaatgaatgaatacagagttcctgaa
ctgaatgttcaaaatggagtgttaaaatcgctttccttcttgtttgaatatattggtgaa
atgggaaaagactacatttatgccgtaacaccgttacttgaagatgctttaatggataga
gaccttgtacacagacagacggctagtgcagtggtacagcacatgtcacttggggtttat
ggatttggttgtgaagattcgctgaatcacttgttgaactatgtatggcccaatgtattt
gagacatctcctcatgtaattcaggcagttatgggagccctagagggcctgagagttgct
attggaccatgtagaatgttgcaatattgtttacagggtctgtttcacccagcccggaaa
gtcagagatgtatattggaaaatttacaactccatctacattggttcccaggacgctctc
atagcacattacccaagaatctacaacgatgataagaacacctatattcgttatgaactt
gactatatcttataa

DBGET integrated database retrieval system