KEGG   Homo sapiens (human): 23451Help
Entry
23451             CDS       T01001                                 

Gene name
SF3B1, Hsh155, MDS, PRP10, PRPF10, SAP155, SF3b155
Definition
splicing factor 3b, subunit 1, 155kDa
Orthology
K12828  
splicing factor 3B subunit 1
Organism
hsa  Homo sapiens (human)
Pathway
Spliceosome
Module
Spliceosome, U2-snRNP
Class
Genetic Information Processing; Transcription; Spliceosome [PATH:hsa03040]
BRITE hierarchy
SSDB OrthologParalogGFIT
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
2q33.1
AA seq 144 aa AA seqDB search
MAKIAKTHEDIEAQIREIQGKKAALDEAQGVGLDSTGYYDQEIYGGSDSRFAGYVTSIAA
TELEDDDDDYSSSTSLLGQKKPGYHAPVALLNDIPQSTEQYDPFAEHRPPKIADREDEYK
KHRRTMIISPERLDPFADGFYSAA
NT seq 435 nt NT seq  +upstreamnt  +downstreamnt
atggcgaagatcgccaagactcacgaagatattgaagcacagattcgagaaattcaaggc
aagaaggcagctcttgatgaagctcaaggagtgggcctcgattctacaggttattatgac
caggaaatttatggtggaagtgacagcagatttgctggatacgtgacatcaattgctgca
actgaacttgaagatgatgacgatgactattcatcatctacgagtttgcttggtcagaag
aagccaggatatcatgcccctgtggcattgcttaatgatataccacagtcaacagaacag
tatgatccatttgctgagcacagacctccaaagattgcagaccgggaagatgaatacaaa
aagcataggcggaccatgataatttccccagagcgtcttgatccttttgcagatggcttc
tattctgctgcttga

DBGET integrated database retrieval system