KEGG   Homo sapiens (human): 23456Help
Entry
23456             CDS       T01001                                 

Gene name
ABCB10, EST20237, M-ABC2, MTABC2
Definition
ATP-binding cassette, sub-family B (MDR/TAP), member 10
Orthology
K05657  
ATP-binding cassette, subfamily B (MDR/TAP), member 10
Organism
hsa  Homo sapiens (human)
Pathway
ABC transporters
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    23456 (ABCB10)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
1q42.13
AA seq 738 aa AA seqDB search
MRGPPAWPLRLLEPPSPAEPGRLLPVACVWAAASRVPGSLSPFTGLRPARLWGAGPALLW
GVGAARRWRSGCRGGGPGASRGVLGLARLLGLWARGPGSCRCGAFAGPGAPRLPRARFPG
GPAAAAWAGDEAWRRGPAAPPGDKGRLRPAAAGLPEARKLLGLAYPERRRLAAAVGFLTM
SSVISMSAPFFLGKIIDVIYTNPTVDYSDNLTRLCLGLSAVFLCGAAANAIRVYLMQTSG
QRIVNRLRTSLFSSILRQEVAFFDKTRTGELINRLSSDTALLGRSVTENLSDGLRAGAQA
SVGISMMFFVSPNLATFVLSVVPPVSIIAVIYGRYLRKLTKVTQDSLAQATQLAEERIGN
VRTVRAFGKEMTEIEKYASKVDHVMQLARKEAFARAGFFGATGLSGNLIVLSVLYKGGLL
MGSAHMTVGELSSFLMYAFWVGISIGGLSSFYSELMKGLGAGGRLWELLEREPKLPFNEG
VILNEKSFQGALEFKNVHFAYPARPEVPIFQDFSLSIPSGSVTALVGPSGSGKSTVLSLL
LRLYDPASGTISLDGHDIRQLNPVWLRSKIGTVSQEPILFSCSIAENIAYGADDPSSVTA
EEIQRVAEVANAVAFIRNFPQGFNTVVGEKGVLLSGGQKQRIAIARALLKNPKILLLDEA
TSALDAENEYLVQEALDRLMDGRTVLVIAHRLSTIKNANMVAVLDQGKITEYGKHEELLS
KPNGIYRKLMNKQSFISA
NT seq 2217 nt NT seq  +upstreamnt  +downstreamnt
atgcgaggcccccctgcctggccgctgcggctgctcgagccaccgagccctgccgagcca
ggtcggctcctgccggtagcctgcgtgtgggccgcggccagccgcgttcccgggtcccta
tcgccgttcactggcctgaggccggcgcggctatggggcgcggggcccgcgctgctctgg
ggcgttggagccgcgcgccgctggaggagcggctgccggggcgggggtccgggcgcctcg
cggggcgtcctgggcctcgcgcggctcctggggctgtgggctcgcggccccggcagctgc
aggtgcggggcttttgccgggccaggcgctcctcggctcccgcgcgcccggttcccgggc
ggtcccgcagccgctgcctgggcaggggacgaggcctggcggcgcgggccggcggcgcct
cccggggacaaggggcggctgcgccccgcagcggccggactcccggaggcccggaagctc
ctggggctggcgtaccctgagcgccggaggctggcagctgcggttggatttctcacgatg
tccagtgttatctccatgtctgcccctttcttcctggggaagatcattgatgtcatctat
accaaccccactgtggactacagcgacaacctgacccgcctctgcctagggctcagtgcc
gtgtttctgtgtggtgctgccgccaatgccattcgtgtctacctcatgcaaacttcaggt
cagcgcattgtgaataggctgagaacttcattattctcctccattctgaggcaggaggtt
gctttctttgacaagactcgcacaggagaattgattaaccgcctctcatcagacactgca
ctcctggggcgctcagtgactgaaaacctctcagatgggctcagggccggggcccaggct
tccgtaggcatcagtatgatgttttttgtctcacctaatctggccacctttgttttgagc
gtggtgcctccagtgtcaatcattgctgtaatttatgggcgatatctacggaaactgacc
aaagtcactcaggattccctggcacaagccactcagctagctgaggaacgtattggaaat
gtaagaactgttcgagcttttgggaaagaaatgactgaaatcgagaaatatgccagcaaa
gtggaccatgtaatgcagttagcaaggaaagaggcattcgcccgggctggtttctttgga
gcaactgggctctccggaaacctgatcgtgctttctgtcctgtacaaaggagggctgctg
atgggcagtgcccacatgaccgtgggtgaactctcttccttcctaatgtatgctttctgg
gttggaataagcattggaggtctgagctctttctactcggagctgatgaaaggactgggt
gcaggggggcgcctctgggagctcctggagagagagcccaagctgccttttaacgagggg
gtcatcttaaatgagaaaagcttccagggtgctttggagtttaagaacgtgcattttgcc
tatccagctcgcccagaggtgcccatatttcaggatttcagcctttccattccgtcagga
tctgtcacggcactggttggcccaagtggttctggcaaatcaacagtgctttcactcctg
ctgaggttgtacgaccctgcttctggaactattagtcttgatggccatgacatccgtcag
ctaaacccagtgtggctgagatccaaaattgggacagtgagtcaggaacccattttgttt
tcttgctctattgctgagaacattgcttatggtgctgatgacccttcctctgtgaccgct
gaggaaatccagagagtggctgaagtggccaatgcagtggccttcatccggaatttcccc
caagggttcaacactgtggttggagaaaagggtgttctcctctcaggtgggcagaaacag
cggattgcgattgcccgtgctctgctaaagaatcccaaaattcttctcctagatgaagca
accagtgcgctggatgccgaaaatgagtaccttgttcaagaagctctagatcgactgatg
gatggaagaacggtgttagttattgcccatcgtctgtccaccattaagaatgctaatatg
gttgctgttcttgaccaaggaaaaattactgaatatggaaaacatgaagagctgctttca
aaaccaaatgggatatacagaaaactaatgaacaaacaaagttttatttcagcataa

DBGET integrated database retrieval system