KEGG   Homo sapiens (human): 23456Help
Entry
23456             CDS       T01001                                 

Gene name
ABCB10, EST20237, M-ABC2, MTABC2
Definition
(RefSeq) ATP binding cassette subfamily B member 10
  KO
K05657  ATP-binding cassette, subfamily B (MDR/TAP), member 10
Organism
hsa  Homo sapiens (human)
Pathway
hsa02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    23456 (ABCB10)
Transporters [BR:hsa02000]
 ABC Transporters, Eukaryotic Type
  ABCB (MDR/TAP) subfamily
   ABCB2, 3, 8, 9, 10 subgroups
    23456 (ABCB10)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ABC_membrane ABC_tran SMC_N AAA_29 ABC_ATPase AAA_21 AAA_16 AAA_22 Zeta_toxin AAA AAA_30 AAA_25 RsgA_GTPase AAA_15 AAA_23 AAA_33 AAA_5 APS_kinase
Motif
Other DBs
NCBI-GeneID: 23456
NCBI-ProteinID: NP_036221
OMIM: 605454
HGNC: 41
Ensembl: ENSG00000135776
Vega: OTTHUMG00000039471
Pharos: Q9NRK6(Tbio)
UniProt: Q9NRK6
Structure
PDB: 

Jmol
Position
1q42.13
AA seq 738 aa AA seqDB search
MRGPPAWPLRLLEPPSPAEPGRLLPVACVWAAASRVPGSLSPFTGLRPARLWGAGPALLW
GVGAARRWRSGCRGGGPGASRGVLGLARLLGLWARGPGSCRCGAFAGPGAPRLPRARFPG
GPAAAAWAGDEAWRRGPAAPPGDKGRLRPAAAGLPEARKLLGLAYPERRRLAAAVGFLTM
SSVISMSAPFFLGKIIDVIYTNPTVDYSDNLTRLCLGLSAVFLCGAAANAIRVYLMQTSG
QRIVNRLRTSLFSSILRQEVAFFDKTRTGELINRLSSDTALLGRSVTENLSDGLRAGAQA
SVGISMMFFVSPNLATFVLSVVPPVSIIAVIYGRYLRKLTKVTQDSLAQATQLAEERIGN
VRTVRAFGKEMTEIEKYASKVDHVMQLARKEAFARAGFFGATGLSGNLIVLSVLYKGGLL
MGSAHMTVGELSSFLMYAFWVGISIGGLSSFYSELMKGLGAGGRLWELLEREPKLPFNEG
VILNEKSFQGALEFKNVHFAYPARPEVPIFQDFSLSIPSGSVTALVGPSGSGKSTVLSLL
LRLYDPASGTISLDGHDIRQLNPVWLRSKIGTVSQEPILFSCSIAENIAYGADDPSSVTA
EEIQRVAEVANAVAFIRNFPQGFNTVVGEKGVLLSGGQKQRIAIARALLKNPKILLLDEA
TSALDAENEYLVQEALDRLMDGRTVLVIAHRLSTIKNANMVAVLDQGKITEYGKHEELLS
KPNGIYRKLMNKQSFISA
NT seq 2217 nt NT seq  +upstreamnt  +downstreamnt
atgcgaggcccccctgcctggccgctgcggctgctcgagccaccgagccctgccgagcca
ggtcggctcctgccggtagcctgcgtgtgggccgcggccagccgcgttcccgggtcccta
tcgccgttcactggcctgaggccggcgcggctatggggcgcggggcccgcgctgctctgg
ggcgttggagccgcgcgccgctggaggagcggctgccggggcgggggtccgggcgcctcg
cggggcgtcctgggcctcgcgcggctcctggggctgtgggctcgcggccccggcagctgc
aggtgcggggcttttgccgggccaggcgctcctcggctcccgcgcgcccggttcccgggc
ggtcccgcagccgctgcctgggcaggggacgaggcctggcggcgcgggccggcggcgcct
cccggggacaaggggcggctgcgccccgcagcggccggactcccggaggcccggaagctc
ctggggctggcgtaccctgagcgccggaggctggcagctgcggttggatttctcacgatg
tccagtgttatctccatgtctgcccctttcttcctggggaagatcattgatgtcatctat
accaaccccactgtggactacagcgacaacctgacccgcctctgcctagggctcagtgcc
gtgtttctgtgtggtgctgccgccaatgccattcgtgtctacctcatgcaaacttcaggt
cagcgcattgtgaataggctgagaacttcattattctcctccattctgaggcaggaggtt
gctttctttgacaagactcgcacaggagaattgattaaccgcctctcatcagacactgca
ctcctggggcgctcagtgactgaaaacctctcagatgggctcagggccggggcccaggct
tccgtaggcatcagtatgatgttttttgtctcacctaatctggccacctttgttttgagc
gtggtgcctccagtgtcaatcattgctgtaatttatgggcgatatctacggaaactgacc
aaagtcactcaggattccctggcacaagccactcagctagctgaggaacgtattggaaat
gtaagaactgttcgagcttttgggaaagaaatgactgaaatcgagaaatatgccagcaaa
gtggaccatgtaatgcagttagcaaggaaagaggcattcgcccgggctggtttctttgga
gcaactgggctctccggaaacctgatcgtgctttctgtcctgtacaaaggagggctgctg
atgggcagtgcccacatgaccgtgggtgaactctcttccttcctaatgtatgctttctgg
gttggaataagcattggaggtctgagctctttctactcggagctgatgaaaggactgggt
gcaggggggcgcctctgggagctcctggagagagagcccaagctgccttttaacgagggg
gtcatcttaaatgagaaaagcttccagggtgctttggagtttaagaacgtgcattttgcc
tatccagctcgcccagaggtgcccatatttcaggatttcagcctttccattccgtcagga
tctgtcacggcactggttggcccaagtggttctggcaaatcaacagtgctttcactcctg
ctgaggttgtacgaccctgcttctggaactattagtcttgatggccatgacatccgtcag
ctaaacccagtgtggctgagatccaaaattgggacagtgagtcaggaacccattttgttt
tcttgctctattgctgagaacattgcttatggtgctgatgacccttcctctgtgaccgct
gaggaaatccagagagtggctgaagtggccaatgcagtggccttcatccggaatttcccc
caagggttcaacactgtggttggagaaaagggtgttctcctctcaggtgggcagaaacag
cggattgcgattgcccgtgctctgctaaagaatcccaaaattcttctcctagatgaagca
accagtgcgctggatgccgaaaatgagtaccttgttcaagaagctctagatcgactgatg
gatggaagaacggtgttagttattgcccatcgtctgtccaccattaagaatgctaatatg
gttgctgttcttgaccaaggaaaaattactgaatatggaaaacatgaagagctgctttca
aaaccaaatgggatatacagaaaactaatgaacaaacaaagttttatttcagcataa

DBGET integrated database retrieval system