KEGG   Homo sapiens (human): 2346Help
Entry
2346              CDS       T01001                                 

Gene name
FOLH1, FGCP, FOLH, GCP2, GCPII, NAALAD1, NAALAdase, PSM, PSMA, mGCP
Definition
folate hydrolase (prostate-specific membrane antigen) 1 (EC:3.4.17.21)
Orthology
K14592  
glutamate carboxypeptidase II (folate hydrolase 1) [EC:3.4.17.21]
Organism
hsa  Homo sapiens (human)
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Vitamin digestion and absorption
Drug target
Indium (111In) capromab pendetide: 
Other: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    2346 (FOLH1)
 Organismal Systems
  Digestive system
   04977 Vitamin digestion and absorption
    2346 (FOLH1)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.17  Metallocarboxypeptidases
    3.4.17.21  glutamate carboxypeptidase II
     2346 (FOLH1)
Peptidases [BR:hsa01002]
 Metallo Peptidases
  Family M28: aminopeptidase Y family
   2346 (FOLH1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
11p11.2
AA seq 719 aa AA seqDB search
MWNLLHETDSAVATARRPRWLCAGALVLAGGFFLLGFLFGWFIKSSNEATNITPKHNMKA
FLDELKAENIKKFLYNFTQIPHLAGTEQNFQLAKQIQSQWKEFGLDSVELAHYDVLLSYP
NKTHPNYISIINEDGNEIFNTSLFEPPPPGYENVSDIVPPFSAFSPQGMPEGDLVYVNYA
RTEDFFKLERDMKINCSGKIVIARYGKVFRGNKVKNAQLAGAKGVILYSDPADYFAPGVK
SYPDGWNLPGGGVQRGNILNLNGAGDPLTPGYPANEYAYRRGIAEAVGLPSIPVHPIGYY
DAQKLLEKMGGSAPPDSSWRGSLKVPYNVGPGFTGNFSTQKVKMHIHSTNEVTRIYNVIG
TLRGAVEPDRYVILGGHRDSWVFGGIDPQSGAAVVHEIVRSFGTLKKEGWRPRRTILFAS
WDAEEFGLLGSTEWAEENSRLLQERGVAYINADSSIEGNYTLRVDCTPLMYSLVHNLTKE
LKSPDEGFEGKSLYESWTKKSPSPEFSGMPRISKLGSGNDFEVFFQRLGIASGRARYTKN
WETNKFSGYPLYHSVYETYELVEKFYDPMFKYHLTVAQVRGGMVFELANSIVLPFDCRDY
AVVLRKYADKIYSISMKHPQEMKTYSVSFDSLFSAVKNFTEIASKFSERLQDFDKSKHVI
YAPSSHNKYAGESFPGIYDALFDIESKVDPSKAWGEVKRQIYVAAFTVQAAAETLSEVA
NT seq 2160 nt NT seq  +upstreamnt  +downstreamnt
atgtggaatctccttcacgaaaccgactcggctgtggccaccgcgcgccgcccgcgctgg
ctgtgcgctggggcgctggtgctggcgggtggcttctttctcctcggcttcctcttcggg
tggtttataaaatcctccaatgaagctactaacattactccaaagcataatatgaaagca
tttttggatgaattgaaagctgagaacatcaagaagttcttatataattttacacagata
ccacatttagcaggaacagaacaaaactttcagcttgcaaagcaaattcaatcccagtgg
aaagaatttggcctggattctgttgagctagcacattatgatgtcctgttgtcctaccca
aataagactcatcccaactacatctcaataattaatgaagatggaaatgagattttcaac
acatcattatttgaaccacctcctccaggatatgaaaatgtttcggatattgtaccacct
ttcagtgctttctctcctcaaggaatgccagagggcgatctagtgtatgttaactatgca
cgaactgaagacttctttaaattggaacgggacatgaaaatcaattgctctgggaaaatt
gtaattgccagatatgggaaagttttcagaggaaataaggttaaaaatgcccagctggca
ggggccaaaggagtcattctctactccgaccctgctgactactttgctcctggggtgaag
tcctatccagatggttggaatcttcctggaggtggtgtccagcgtggaaatatcctaaat
ctgaatggtgcaggagaccctctcacaccaggttacccagcaaatgaatatgcttatagg
cgtggaattgcagaggctgttggtcttccaagtattcctgttcatccaattggatactat
gatgcacagaagctcctagaaaaaatgggtggctcagcaccaccagatagcagctggaga
ggaagtctcaaagtgccctacaatgttggacctggctttactggaaacttttctacacaa
aaagtcaagatgcacatccactctaccaatgaagtgacaagaatttacaatgtgataggt
actctcagaggagcagtggaaccagacagatatgtcattctgggaggtcaccgggactca
tgggtgtttggtggtattgaccctcagagtggagcagctgttgttcatgaaattgtgagg
agctttggaacactgaaaaaggaagggtggagacctagaagaacaattttgtttgcaagc
tgggatgcagaagaatttggtcttcttggttctactgagtgggcagaggagaattcaaga
ctccttcaagagcgtggcgtggcttatattaatgctgactcatctatagaaggaaactac
actctgagagttgattgtacaccgctgatgtacagcttggtacacaacctaacaaaagag
ctgaaaagccctgatgaaggctttgaaggcaaatctctttatgaaagttggactaaaaaa
agtccttccccagagttcagtggcatgcccaggataagcaaattgggatctggaaatgat
tttgaggtgttcttccaacgacttggaattgcttcaggcagagcacggtatactaaaaat
tgggaaacaaacaaattcagcggctatccactgtatcacagtgtctatgaaacatatgag
ttggtggaaaagttttatgatccaatgtttaaatatcacctcactgtggcccaggttcga
ggagggatggtgtttgagctagccaattccatagtgctcccttttgattgtcgagattat
gctgtagttttaagaaagtatgctgacaaaatctacagtatttctatgaaacatccacag
gaaatgaagacatacagtgtatcatttgattcacttttttctgcagtaaagaattttaca
gaaattgcttccaagttcagtgagagactccaggactttgacaaaagcaagcatgtcatc
tatgctccaagcagccacaacaagtatgcaggggagtcattcccaggaatttatgatgct
ctgtttgatattgaaagcaaagtggacccttccaaggcctggggagaagtgaagagacag
atttatgttgcagccttcacagtgcaggcagctgcagagactttgagtgaagtagcctaa

DBGET integrated database retrieval system