KEGG   Homo sapiens (human): 2346Help
Entry
2346              CDS       T01001                                 

Gene name
FOLH1, FGCP, FOLH, GCP2, GCPII, NAALAD1, NAALAdase, PSM, PSMA, mGCP
Definition
(RefSeq) folate hydrolase 1
  KO
K14592  glutamate carboxypeptidase II (folate hydrolase 1) [EC:3.4.17.21]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00250  Alanine, aspartate and glutamate metabolism
hsa01100  Metabolic pathways
hsa04977  Vitamin digestion and absorption
Drug target
Capromab pendetide: D03372
Indium (111In) capromab pendetide: D04525
Iofolastat I 123: D10070
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    2346 (FOLH1)
 Organismal Systems
  Digestive system
   04977 Vitamin digestion and absorption
    2346 (FOLH1)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.17  Metallocarboxypeptidases
    3.4.17.21  glutamate carboxypeptidase II
     2346 (FOLH1)
Peptidases [BR:hsa01002]
 Metallo Peptidases
  Family M28: aminopeptidase Y family
   2346 (FOLH1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TFR_dimer Peptidase_M28 PA
Motif
Other DBs
NCBI-GeneID: 2346
NCBI-ProteinID: NP_004467
OMIM: 600934
HGNC: 3788
Ensembl: ENSG00000086205
Vega: OTTHUMG00000166625
Pharos: Q04609(Tchem)
UniProt: Q04609
Structure
PDB: 

Jmol
Position
11p11.12
AA seq 750 aa AA seqDB search
MWNLLHETDSAVATARRPRWLCAGALVLAGGFFLLGFLFGWFIKSSNEATNITPKHNMKA
FLDELKAENIKKFLYNFTQIPHLAGTEQNFQLAKQIQSQWKEFGLDSVELAHYDVLLSYP
NKTHPNYISIINEDGNEIFNTSLFEPPPPGYENVSDIVPPFSAFSPQGMPEGDLVYVNYA
RTEDFFKLERDMKINCSGKIVIARYGKVFRGNKVKNAQLAGAKGVILYSDPADYFAPGVK
SYPDGWNLPGGGVQRGNILNLNGAGDPLTPGYPANEYAYRRGIAEAVGLPSIPVHPIGYY
DAQKLLEKMGGSAPPDSSWRGSLKVPYNVGPGFTGNFSTQKVKMHIHSTNEVTRIYNVIG
TLRGAVEPDRYVILGGHRDSWVFGGIDPQSGAAVVHEIVRSFGTLKKEGWRPRRTILFAS
WDAEEFGLLGSTEWAEENSRLLQERGVAYINADSSIEGNYTLRVDCTPLMYSLVHNLTKE
LKSPDEGFEGKSLYESWTKKSPSPEFSGMPRISKLGSGNDFEVFFQRLGIASGRARYTKN
WETNKFSGYPLYHSVYETYELVEKFYDPMFKYHLTVAQVRGGMVFELANSIVLPFDCRDY
AVVLRKYADKIYSISMKHPQEMKTYSVSFDSLFSAVKNFTEIASKFSERLQDFDKSNPIV
LRMMNDQLMFLERAFIDPLGLPDRPFYRHVIYAPSSHNKYAGESFPGIYDALFDIESKVD
PSKAWGEVKRQIYVAAFTVQAAAETLSEVA
NT seq 2253 nt NT seq  +upstreamnt  +downstreamnt
atgtggaatctccttcacgaaaccgactcggctgtggccaccgcgcgccgcccgcgctgg
ctgtgcgctggggcgctggtgctggcgggtggcttctttctcctcggcttcctcttcggg
tggtttataaaatcctccaatgaagctactaacattactccaaagcataatatgaaagca
tttttggatgaattgaaagctgagaacatcaagaagttcttatataattttacacagata
ccacatttagcaggaacagaacaaaactttcagcttgcaaagcaaattcaatcccagtgg
aaagaatttggcctggattctgttgagctagcacattatgatgtcctgttgtcctaccca
aataagactcatcccaactacatctcaataattaatgaagatggaaatgagattttcaac
acatcattatttgaaccacctcctccaggatatgaaaatgtttcggatattgtaccacct
ttcagtgctttctctcctcaaggaatgccagagggcgatctagtgtatgttaactatgca
cgaactgaagacttctttaaattggaacgggacatgaaaatcaattgctctgggaaaatt
gtaattgccagatatgggaaagttttcagaggaaataaggttaaaaatgcccagctggca
ggggccaaaggagtcattctctactccgaccctgctgactactttgctcctggggtgaag
tcctatccagatggttggaatcttcctggaggtggtgtccagcgtggaaatatcctaaat
ctgaatggtgcaggagaccctctcacaccaggttacccagcaaatgaatatgcttatagg
cgtggaattgcagaggctgttggtcttccaagtattcctgttcatccaattggatactat
gatgcacagaagctcctagaaaaaatgggtggctcagcaccaccagatagcagctggaga
ggaagtctcaaagtgccctacaatgttggacctggctttactggaaacttttctacacaa
aaagtcaagatgcacatccactctaccaatgaagtgacaagaatttacaatgtgataggt
actctcagaggagcagtggaaccagacagatatgtcattctgggaggtcaccgggactca
tgggtgtttggtggtattgaccctcagagtggagcagctgttgttcatgaaattgtgagg
agctttggaacactgaaaaaggaagggtggagacctagaagaacaattttgtttgcaagc
tgggatgcagaagaatttggtcttcttggttctactgagtgggcagaggagaattcaaga
ctccttcaagagcgtggcgtggcttatattaatgctgactcatctatagaaggaaactac
actctgagagttgattgtacaccgctgatgtacagcttggtacacaacctaacaaaagag
ctgaaaagccctgatgaaggctttgaaggcaaatctctttatgaaagttggactaaaaaa
agtccttccccagagttcagtggcatgcccaggataagcaaattgggatctggaaatgat
tttgaggtgttcttccaacgacttggaattgcttcaggcagagcacggtatactaaaaat
tgggaaacaaacaaattcagcggctatccactgtatcacagtgtctatgaaacatatgag
ttggtggaaaagttttatgatccaatgtttaaatatcacctcactgtggcccaggttcga
ggagggatggtgtttgagctagccaattccatagtgctcccttttgattgtcgagattat
gctgtagttttaagaaagtatgctgacaaaatctacagtatttctatgaaacatccacag
gaaatgaagacatacagtgtatcatttgattcacttttttctgcagtaaagaattttaca
gaaattgcttccaagttcagtgagagactccaggactttgacaaaagcaacccaatagta
ttaagaatgatgaatgatcaactcatgtttctggaaagagcatttattgatccattaggg
ttaccagacaggcctttttataggcatgtcatctatgctccaagcagccacaacaagtat
gcaggggagtcattcccaggaatttatgatgctctgtttgatattgaaagcaaagtggac
ccttccaaggcctggggagaagtgaagagacagatttatgttgcagccttcacagtgcag
gcagctgcagagactttgagtgaagtagcctaa

DBGET integrated database retrieval system