KEGG   Homo sapiens (human): 23461Help
Entry
23461             CDS       T01001                                 

Gene name
ABCA5, ABC13, EST90625
Definition
ATP-binding cassette, sub-family A (ABC1), member 5
Orthology
K05648  
ATP-binding cassette, subfamily A (ABC1), member 5
Organism
hsa  Homo sapiens (human)
Pathway
ABC transporters
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    23461 (ABCA5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
17q24.3
AA seq 1642 aa AA seqDB search
MSTAIREVGVWRQTRTLLLKNYLIKCRTKKSSVQEILFPLFFLFWLILISMMHPNKKYEE
VPNIELNPMDKFTLSNLILGYTPVTNITSSIMQKVSTDHLPDVIITEEYTNEKEMLTSSL
SKPSNFVGVVFKDSMSYELRFFPDMIPVSSIYMDSRAGCSKSCEAAQYWSSGFTVLQASI
DAAIIQLKTNVSLWKELESTKAVIMGETAVVEIDTFPRGVILIYLVIAFSPFGYFLAIHI
VAEKEKKIKEFLKIMGLHDTAFWLSWVLLYTSLIFLMSLLMAVIATASLLFPQSSSIVIF
LLFFLYGLSSVFFALMLTPLFKKSKHVGIVEFFVTVAFGFIGLMIILIESFPKSLVWLFS
PFCHCTFVIGIAQVMHLEDFNEGASFSNLTAGPYPLIITIIMLTLNSIFYVLLAVYLDQV
IPGEFGLRRSSLYFLKPSYWSKSKRNYEELSEGNVNGNISFSEIIEPVSSEFVGKEAIRI
SGIQKTYRKKGENVEALRNLSFDIYEGQITALLGHSGTGKSTLMNILCGLCPPSDGFASI
YGHRVSEIDEMFEARKMIGICPQLDIHFDVLTVEENLSILASIKGIPANNIIQEVQKVLL
DLDMQTIKDNQAKKLSGGQKRKLSLGIAVLGNPKILLLDEPTAGMDPCSRHIVWNLLKYR
KANRVTVFSTHFMDEADILADRKAVISQGMLKCVGSSMFLKSKWGIGYRLSMYIDKYCAT
ESLSSLVKQHIPGATLLQQNDQQLVYSLPFKDMDKFSGLFSALDSHSNLGVISYGVSMTT
LEDVFLKLEVEAEIDQADYSVFTQQPLEEEMDSKSFDEMEQSLLILSETKAALVSTMSLW
KQQMYTIAKFHFFTLKRESKSVRSVLLLLLIFFTVQIFMFLVHHSFKNAVVPIKLVPDLY
FLKPGDKPHKYKTSLLLQNSADSDISDLISFFTSQNIMVTMINDSDYVSVAPHSAALNVM
HSEKDYVFAAVFNSTMVYSLPILVNIISNYYLYHLNVTETIQIWSTPFFQEITDIVFKIE
LYFQAALLGIIVTAMPPYFAMENAENHKIKAYTQLKLSGLLPSAYWIGQAVVDIPLFFII
LILMLGSLLAFHYGLYFYTVKFLAVVFCLIGYVPSVILFTYIASFTFKKILNTKEFWSFI
YSVAALACIAITEITFFMGYTIATILHYAFCIIIPIYPLLGCLISFIKISWKNVRKNVDT
YNPWDRLSVAVISPYLQCVLWIFLLQYYEKKYGGRSIRKDPFFRNLSTKSKNRKLPEPPD
NEDEDEDVKAERLKVKELMGCQCCEEKPSIMVSNLHKEYDDKKDFLLSRKVKKVATKYIS
FCVKKGEILGLLGPNGAGKSTIINILVGDIEPTSGQVFLGDYSSETSEDDDSLKCMGYCP
QINPLWPDTTLQEHFEIYGAVKGMSASDMKEVISRITHALDLKEHLQKTVKKLPAGIKRK
LCFALSMLGNPQITLLDEPSTGMDPKAKQHMWRAIRTAFKNRKRAAILTTHYMEEAEAVC
DRVAIMVSGQLRCIGTVQHLKSKFGKGYFLEIKLKDWIENLEVDRLQREIQYIFPNASRQ
ESFSSILAYKIPKEDVQSLSQSFFKLEEAKHAFAIEEYSFSQATLEQVFVELTKEQEEED
NSCGTLNSTLWWERTQEDRVVF
NT seq 4929 nt NT seq  +upstreamnt  +downstreamnt
atgtccactgcaattagggaggtaggagtttggagacagaccagaacacttctactgaag
aattacttaattaaatgcagaaccaaaaagagtagtgttcaggaaattctttttccacta
ttttttttattttggttaatattaattagcatgatgcatccaaataagaaatatgaagaa
gtgcctaatatagaactcaatcctatggacaagtttactctttctaatctaattcttgga
tatactccagtgactaatattacaagcagcatcatgcagaaagtgtctactgatcatcta
cctgatgtcataattactgaagaatatacaaatgaaaaagaaatgttaacatccagtctc
tctaagccgagcaactttgtaggtgtggttttcaaagactccatgtcctatgaacttcgt
ttttttcctgatatgattccagtatcttctatttatatggattcaagagctggctgttca
aaatcatgtgaggctgctcagtactggtcctcaggtttcacagttttacaagcatccata
gatgctgccattatacagttgaagaccaatgtttctctttggaaggagctggagtcaact
aaagctgttattatgggagaaactgctgttgtagaaatagatacctttccccgaggagta
attttaatatacctagttatagcattttcaccttttggatactttttggcaattcatatc
gtagcagaaaaagaaaaaaaaataaaagaatttttaaagataatgggacttcatgatact
gccttttggctttcctgggttcttctatatacaagtttaatttttcttatgtcccttctt
atggcagtcattgcgacagcttctttgttatttcctcaaagtagcagcattgtgatattt
ctgctttttttcctttatggattatcatctgtattttttgctttaatgctgacacctctt
tttaaaaaatcaaaacatgtgggaatagttgaattttttgttactgtggcttttggattt
attggccttatgataatcctcatagaaagttttcccaaatcgttagtgtggcttttcagt
cctttctgtcactgtacttttgtgattggtattgcacaggtcatgcatttagaagatttt
aatgaaggtgcttcattttcaaatttgactgcaggcccatatcctctaattattacaatt
atcatgctcacacttaatagtatattctatgtcctcttggctgtctatcttgatcaagtc
attccaggggaatttggcttacggagatcatctttatattttctgaagccttcatattgg
tcaaagagcaaaagaaattatgaggagttatcagagggcaatgttaatggaaatattagt
tttagtgaaattattgagccagtttcttcagaatttgtaggaaaagaagccataagaatt
agtggtattcagaagacatacagaaagaagggtgaaaatgtggaggctttgagaaatttg
tcatttgacatatatgagggtcagattactgccttacttggccacagtggaacaggaaag
agtacattgatgaatattctttgtggactctgcccaccttctgatgggtttgcatctata
tatggacacagagtctcagaaatagatgaaatgtttgaagcaagaaaaatgattggcatt
tgtccacagttagatatacactttgatgttttgacagtagaagaaaatttatcaattttg
gcttcaatcaaagggataccagccaacaatataatacaagaagtgcagaaggttttacta
gatttagacatgcagactatcaaagataaccaagctaaaaaattaagtggtggtcaaaaa
agaaagctgtcattaggaattgctgttcttgggaacccaaagatactgctgctagatgaa
ccaacagctggaatggacccctgttctcgacatattgtatggaatcttttaaaatacaga
aaagccaatcgggtgacagtgttcagtactcatttcatggatgaagctgacattcttgca
gataggaaagctgtgatatcacaaggaatgctgaaatgtgttggttcttcaatgttcctc
aaaagtaaatgggggatcggctaccgcctgagcatgtacatagacaaatattgtgccaca
gaatctctttcttcactggttaaacaacatatacctggagctactttattacaacagaat
gaccaacaacttgtgtatagcttgcctttcaaggacatggacaaattttcaggtttgttt
tctgccctagacagtcattcaaatttgggtgtcatttcttatggtgtttccatgacgact
ttggaagacgtatttttaaagctagaagttgaagcagaaattgaccaagcagattatagt
gtatttactcagcagccactggaggaagaaatggattcaaaatcttttgatgaaatggaa
cagagcttacttattctttctgaaaccaaggctgctctagtgagcaccatgagcctttgg
aaacaacagatgtatacaatagcaaagtttcatttctttaccttgaaacgtgaaagtaaa
tcagtgagatcagtgttgcttctgcttttaatttttttcacagttcagatttttatgttt
ttggttcatcactcttttaaaaatgctgtggttcccatcaaacttgttccagacttatat
tttctaaaacctggagacaaaccacataaatacaaaacaagtctgcttcttcaaaattct
gctgactcagatatcagtgatcttattagctttttcacaagccagaacataatggtgacg
atgattaatgacagtgactatgtatccgtggctccccatagtgcggctttaaatgtgatg
cattcagaaaaggactatgtttttgcagctgttttcaacagtactatggtttattcttta
cctatattagtgaatatcattagtaactactatctttatcatttaaatgtgactgaaacc
atccagatctggagtaccccattctttcaagaaattactgatatagtttttaaaattgag
ctgtattttcaagcagctttgcttggaatcattgttactgcaatgccaccttactttgcc
atggaaaatgcagagaatcataagatcaaagcttatactcaacttaaactttcaggtctt
ttgccatctgcatattggattggacaagctgttgttgatatccccttattttttatcatt
cttattttgatgctaggaagcttattggcatttcattatggattatatttttatactgta
aagttccttgctgtggttttttgccttattggttatgttccatcagttattctgttcact
tatattgcttctttcacctttaagaaaattttaaataccaaagaattttggtcatttatc
tattctgtggcagcgttggcttgtattgcaatcactgaaataactttctttatgggatac
acaattgcaactattcttcattatgccttttgtatcatcattccaatctatccacttcta
ggttgcctgatttctttcataaagatttcttggaagaatgtacgaaaaaatgtggacacc
tataatccatgggataggctttcagtagctgttatatcgccttacctgcagtgtgtactg
tggattttcctcttacaatactatgagaaaaaatatggaggcagatcaataagaaaagat
ccctttttcagaaacctttcaacgaagtctaaaaataggaagcttccagaaccaccagac
aatgaggatgaagatgaagatgtcaaagctgaaagactaaaggtcaaagagctgatgggt
tgccagtgttgtgaggagaaaccatccattatggtcagcaatttgcataaagaatatgat
gacaagaaagattttcttctttcaagaaaagtaaagaaagtggcaactaaatacatctct
ttctgtgtgaaaaaaggagagatcttaggactattgggtccaaatggtgctggcaaaagc
acaattattaatattctggttggtgatattgaaccaacttcaggccaggtatttttagga
gattattcttcagagacaagtgaagatgatgattcactgaagtgtatgggttactgtcct
cagataaaccctttgtggccagatactacattgcaggaacattttgaaatttatggagct
gtcaaaggaatgagtgcaagtgacatgaaagaagtcataagtcgaataacacatgcactt
gatttaaaagaacatcttcagaagactgtaaagaaactacctgcaggaatcaaacgaaag
ttgtgttttgctctaagtatgctagggaatcctcagattactttgctagatgaaccatct
acaggtatggatcccaaagccaaacagcacatgtggcgagcaattcgaactgcatttaaa
aacagaaagcgggctgctattctgaccactcactatatggaggaggcagaggctgtctgt
gatcgagtagctatcatggtgtctgggcagttaagatgtatcggaacagtacaacatcta
aagagtaaatttggaaaaggctactttttggaaattaaattgaaggactggatagaaaac
ctagaagtagaccgccttcaaagagaaattcagtatattttcccaaatgcaagccgtcag
gaaagtttttcttctattttggcttataaaattcctaaggaagatgttcagtccctttca
caatctttttttaagctggaagaagctaaacatgcttttgccattgaagaatatagcttt
tctcaagcaacattggaacaggtttttgtagaactcactaaagaacaagaggaggaagat
aatagttgtggaactttaaacagcacactttggtgggaacgaacacaagaagatagagta
gtattttga

DBGET integrated database retrieval system