KEGG   Homo sapiens (human): 23475Help
Entry
23475             CDS       T01001                                 

Gene name
QPRT, HEL-S-90n, QPRTase
Definition
quinolinate phosphoribosyltransferase (EC:2.4.2.19)
Orthology
K00767  
nicotinate-nucleotide pyrophosphorylase (carboxylating) [EC:2.4.2.19]
Organism
hsa  Homo sapiens (human)
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    23475 (QPRT)
Enzymes [BR:hsa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.19  nicotinate-nucleotide diphosphorylase (carboxylating)
     23475 (QPRT)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
UniProt: 
Structure
PDB: 

Jmol
Position
16p11.2
AA seq 297 aa AA seqDB search
MDAEGLALLLPPVTLAALVDSWLREDCPGLNYAALVSGAGPSQAALWAKSPGVLAGQPFF
DAIFTQLNCQVSWFLPEGSKLVPVARVAEVRGPAHCLLLGERVALNTLARCSGIASAAAA
AVEAARGAGWTGHVAGTRKTTPGFRLVEKYGLLVGGAASHRYDLGGLVMVKDNHVVAAGG
VEKAVRAARQAADFALKVEVECSSLQEAVQAAEAGADLVLLDNFKPEELHPTATVLKAQF
PSVAVEASGGITLDNLPQFCGPHIDVISMGMLTQAAPALDFSLKLFAKEVAPVPKIH
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atggacgctgaaggcctggcgctgctgctgccgcccgtcaccctggcagccctggtggac
agctggctccgagaggactgcccagggctcaactacgcagccttggtcagcggggcaggc
ccctcgcaggcggcgctgtgggccaaatcccctggggtactggcagggcagcctttcttc
gatgccatatttacccaactcaactgccaagtctcctggttcctccccgagggatcgaag
ctggtgccggtggccagagtggccgaggtccggggccctgcccactgcctgctgctgggg
gaacgggtggccctcaacacgctggcccgctgcagtggcattgccagtgctgccgccgct
gcagtggaggccgccaggggggccggctggactgggcacgtggcaggcacgaggaagacc
acgccaggcttccggctggtggagaagtatgggctcctggtgggcggggccgcctcgcac
cgctacgacctgggagggctggtgatggtgaaggataaccatgtggtggccgccggtggc
gtggagaaggcggtgcgggcggccagacaggcggctgacttcgctctgaaggtggaagtg
gaatgcagcagcctgcaggaggccgtgcaggcagctgaggctggtgccgaccttgtcctg
ctggacaacttcaagccagaggagctgcaccccacggccaccgtgctgaaggcccagttc
ccgagtgtggctgtggaagccagtgggggcatcaccctggacaacctcccccagttctgc
gggccgcacatagacgtcatctccatggggatgctgacccaggcggccccagcccttgat
ttctccctcaagctgtttgccaaagaggtggctccagtgcccaaaatccactag

DBGET integrated database retrieval system