KEGG   Homo sapiens (human): 23476Help
Entry
23476             CDS       T01001                                 

Gene name
BRD4, CAP, HUNK1, HUNKI, MCAP
Definition
(RefSeq) bromodomain containing 4 (EC:3.1.1.31)
  KO
K11722  
bromodomain-containing protein 4
Organism
hsa  Homo sapiens (human)
Brite
Protein kinases [BR:hsa01001]
 Serine/threonine protein kinases: Atypical group
  BRD family [OT]
   23476 (BRD4)
Transcription machinery [BR:hsa03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Brd4/P-TEFb complex
     23476 (BRD4)
Chromosome [BR:hsa03036]
 Eukaryotic Type
  Chromatin remodeling factors
   Other chromatin remodeling factors
    23476 (BRD4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
19p13.1
AA seq 1362 aa AA seqDB search
MSAESGPGTRLRNLPVMGDGLETSQMSTTQAQAQPQPANAASTNPPPPETSNPNKPKRQT
NQLQYLLRVVLKTLWKHQFAWPFQQPVDAVKLNLPDYYKIIKTPMDMGTIKKRLENNYYW
NAQECIQDFNTMFTNCYIYNKPGDDIVLMAEALEKLFLQKINELPTEETEIMIVQAKGRG
RGRKETGTAKPGVSTVPNTTQASTPPQTQTPQPNPPPVQATPHPFPAVTPDLIVQTPVMT
VVPPQPLQTPPPVPPQPQPPPAPAPQPVQSHPPIIAATPQPVKTKKGVKRKADTTTPTTI
DPIHEPPSLPPEPKTTKLGQRRESSRPVKPPKKDVPDSQQHPAPEKSSKVSEQLKCCSGI
LKEMFAKKHAAYAWPFYKPVDVEALGLHDYCDIIKHPMDMSTIKSKLEAREYRDAQEFGA
DVRLMFSNCYKYNPPDHEVVAMARKLQDVFEMRFAKMPDEPEEPVVAVSSPAVPPPTKVV
APPSSSDSSSDSSSDSDSSTDDSEEERAQRLAELQEQLKAVHEQLAALSQPQQNKPKKKE
KDKKEKKKEKHKRKEEVEENKKSKAKEPPPKKTKKNNSSNSNVSKKEPAPMKSKPPPTYE
SEEEDKCKPMSYEEKRQLSLDINKLPGEKLGRVVHIIQSREPSLKNSNPDEIEIDFETLK
PSTLRELERYVTSCLRKKRKPQAEKVDVIAGSSKMKGFSSSESESSSESSSSDSEDSETE
MAPKSKKKGHPGREQKKHHHHHHQQMQQAPAPVPQQPPPPPQQPPPPPPPQQQQQPPPPP
PPPSMPQQAAPAMKSSPPPFIATQVPVLEPQLPGSVFDPIGHFTQPILHLPQPELPPHLP
QPPEHSTPPHLNQHAVVSPPALHNALPQQPSRPSNRAAALPPKPARPPAVSPALTQTPLL
PQPPMAQPPQVLLEDEEPPAPPLTSMQMQLYLQQLQKVQPPTPLLPSVKVQSQPPPPLPP
PPHPSVQQQLQQQPPPPPPPQPQPPPQQQHQPPPRPVHLQPMQFSTHIQQPPPPQGQQPP
HPPPGQQPPPPQPAKPQQVIQHHHSPRHHKSDPYSTGHLREAPSPLMIHSPQMSQFQSLT
HQSPPQQNVQPKKQELRAASVVQPQPLVVVKEEKIHSPIIRSEPFSPSLRPEPPKHPESI
KAPVHLPQRPEMKPVDVGRPVIRPPEQNAPPPGAPDKDKQKQEPKTPVAPKKDLKIKNMG
SWASLVQKHPTTPSSTAKSSSDSFEQFRRAAREKEEREKALKAQAEHAEKEKERLRQERM
RSREDEDALEQARRAHEEARRRQEQQQQQRQEQQQQQQQQAAAVAAAATPQAQSSQPQSM
LDQQRELARKREQERRRREAMAATIDMNFQSDLLSIFEENLF
NT seq 4089 nt NT seq  +upstreamnt  +downstreamnt
atgtctgcggagagcggccctgggacgagattgagaaatctgccagtaatgggggatgga
ctagaaacttcccaaatgtctacaacacaggcccaggcccaaccccagccagccaacgca
gccagcaccaaccccccgcccccagagacctccaaccctaacaagcccaagaggcagacc
aaccaactgcaatacctgctcagagtggtgctcaagacactatggaaacaccagtttgca
tggcctttccagcagcctgtggatgccgtcaagctgaacctccctgattactataagatc
attaaaacgcctatggatatgggaacaataaagaagcgcttggaaaacaactattactgg
aatgctcaggaatgtatccaggacttcaacactatgtttacaaattgttacatctacaac
aagcctggagatgacatagtcttaatggcagaagctctggaaaagctcttcttgcaaaaa
ataaatgagctacccacagaagaaaccgagatcatgatagtccaggcaaaaggaagagga
cgtgggaggaaagaaacagggacagcaaaacctggcgtttccacggtaccaaacacaact
caagcatcgactcctccgcagacccagacccctcagccgaatcctcctcctgtgcaggcc
acgcctcaccccttccctgccgtcaccccggacctcatcgtccagacccctgtcatgaca
gtggtgcctccccagccactgcagacgcccccgccagtgcccccccagccacaaccccca
cccgctccagctccccagcccgtacagagccacccacccatcatcgcggccaccccacag
cctgtgaagacaaagaagggagtgaagaggaaagcagacaccaccacccccaccaccatt
gaccccattcacgagccaccctcgctgcccccggagcccaagaccaccaagctgggccag
cggcgggagagcagccggcctgtgaaacctccaaagaaggacgtgcccgactctcagcag
cacccagcaccagagaagagcagcaaggtctcggagcagctcaagtgctgcagcggcatc
ctcaaggagatgtttgccaagaagcacgccgcctacgcctggcccttctacaagcctgtg
gacgtggaggcactgggcctacacgactactgtgacatcatcaagcaccccatggacatg
agcacaatcaagtctaaactggaggcccgtgagtaccgtgatgctcaggagtttggtgct
gacgtccgattgatgttctccaactgctataagtacaaccctcctgaccatgaggtggtg
gccatggcccgcaagctccaggatgtgttcgaaatgcgctttgccaagatgccggacgag
cctgaggagccagtggtggccgtgtcctccccggcagtgccccctcccaccaaggttgtg
gccccgccctcatccagcgacagcagcagcgatagctcctcggacagtgacagttcgact
gatgactctgaggaggagcgagcccagcggctggctgagctccaggagcagctcaaagcc
gtgcacgagcagcttgcagccctctctcagccccagcagaacaaaccaaagaaaaaggag
aaagacaagaaggaaaagaaaaaagaaaagcacaaaaggaaagaggaagtggaagagaat
aaaaaaagcaaagccaaggaacctcctcctaaaaagacgaagaaaaataatagcagcaac
agcaatgtgagcaagaaggagccagcgcccatgaagagcaagccccctcccacgtatgag
tcggaggaagaggacaagtgcaagcctatgtcctatgaggagaagcggcagctcagcttg
gacatcaacaagctccccggcgagaagctgggccgcgtggtgcacatcatccagtcacgg
gagccctccctgaagaattccaaccccgacgagattgaaatcgactttgagaccctgaag
ccgtccacactgcgtgagctggagcgctatgtcacctcctgtttgcggaagaaaaggaaa
cctcaagctgagaaagttgatgtgattgccggctcctccaagatgaagggcttctcgtcc
tcagagtcggagagctccagtgagtccagctcctctgacagcgaagactccgaaacagag
atggctccgaagtcaaaaaagaaggggcaccccgggagggagcagaagaagcaccatcat
caccaccatcagcagatgcagcaggccccggctcctgtgccccagcagccgcccccgcct
ccccagcagcccccaccgcctccacctccgcagcagcaacagcagccgccacccccgcct
cccccaccctccatgccgcagcaggcagccccggcgatgaagtcctcgcccccacccttc
attgccacccaggtgcccgtcctggagccccagctcccaggcagcgtctttgaccccatc
ggccacttcacccagcccatcctgcacctgccgcagcctgagctgccccctcacctgccc
cagccgcctgagcacagcactccaccccatctcaaccagcacgcagtggtctctcctcca
gctttgcacaacgcactaccccagcagccatcacggcccagcaaccgagccgctgccctg
cctcccaagcccgcccggcccccagccgtgtcaccagccttgacccaaacacccctgctc
ccacagccccccatggcccaacccccccaagtgctgctggaggatgaagagccacctgcc
ccacccctcacctccatgcagatgcagctgtacctgcagcagctgcagaaggtgcagccc
cctacgccgctactcccttccgtgaaggtgcagtcccagcccccaccccccctgccgccc
ccaccccacccctctgtgcagcagcagctgcagcagcagccgccaccacccccaccaccc
cagccccagcctccaccccagcagcagcatcagccccctccacggcccgtgcacttgcag
cccatgcagttttccacccacatccaacagcccccgccaccccagggccagcagcccccc
catccgcccccaggccagcagccacccccgccgcagcctgccaagcctcagcaagtcatc
cagcaccaccattcaccccggcaccacaagtcggacccctactcaaccggtcacctccgc
gaagccccctccccgcttatgatacattccccccagatgtcacagttccagagcctgacc
caccagtctccaccccagcaaaacgtccagcctaagaaacaggagctgcgtgctgcctcc
gtggtccagccccagcccctcgtggtggtgaaggaggagaagatccactcacccatcatc
cgcagcgagcccttcagcccctcgctgcggccggagccccccaagcacccggagagcatc
aaggcccccgtccacctgccccagcggccggaaatgaagcctgtggatgtcgggaggcct
gtgatccggcccccagagcagaacgcaccgccaccaggggcccctgacaaggacaaacag
aaacaggagccgaagactccagttgcgcccaaaaaggacctgaaaatcaagaacatgggc
tcctgggccagcctagtgcagaagcatccgaccaccccctcctccacagccaagtcatcc
agcgacagcttcgagcagttccgccgcgccgctcgggagaaagaggagcgtgagaaggcc
ctgaaggctcaggccgagcacgctgagaaggagaaggagcggctgcggcaggagcgcatg
aggagccgagaggacgaggatgcgctggagcaggcccggcgggcccatgaggaggcacgt
cggcgccaggagcagcagcagcagcagcgccaggagcaacagcagcagcagcaacagcaa
gcagctgcggtggctgccgccgccaccccacaggcccagagctcccagccccagtccatg
ctggaccagcagagggagttggcccggaagcgggagcaggagcgaagacgccgggaagcc
atggcagctaccattgacatgaatttccagagtgatctattgtcaatatttgaagaaaat
cttttctga

DBGET integrated database retrieval system