KEGG   Homo sapiens (human): 23476Help
Entry
23476             CDS       T01001                                 

Gene name
BRD4, CAP, HUNK1, HUNKI, MCAP
Definition
(RefSeq) bromodomain containing 4 (EC:3.1.1.31)
  KO
K11722  
bromodomain-containing protein 4
Organism
hsa  Homo sapiens (human)
Brite
Protein kinases [BR:hsa01001]
 Serine/threonine protein kinases: Atypical group
  BRD family [OT]
   23476 (BRD4)
Transcription machinery [BR:hsa03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Brd4/P-TEFb complex
     23476 (BRD4)
Chromosome [BR:hsa03036]
 Eukaryotic Type
  Chromatin remodeling factors
   Other chromatin remodeling factors
    23476 (BRD4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 
4QB3 4ZC9 5EI4 4Z1S 5DW2 5KU3 5CFW 5LJ2 4UIZ 4X2I 4NUD 4J3I 4PCI 4IOO 4Z93 4QR4 4PCE 4LR6 4UIY 4NUE 4LYI 4CFL 4YH4 4O78 4O7A 5E0R 4WHW 2OSS 5A5S 4O71 4UYD 4QR3 3UVW 3U5L 5I88 5HM0 4Z1Q 4PS5 4CL9 4O72 4NUC 4BW1 4IOR 4F3I 4QR5 4HXS 5I80 4QZS 4O74 5KHM 5AD3 5D0C 4HXN 5D3L 5BT4 4O7B 4BW3 4KV1 4IOQ 4HXM 3ZYU 4HXL 4DON 4HXR 5CY9 4O70 4O75 4O7C 4CFK 4C67 4WIV 4UIX 4NQM 4BJX 4HBY 2NNU 5EIS 5CQT 4YH3 4CLB 4GPJ 4A9L 3U5J 3P5O 3MXF 5LUU 4HXK 5CS8 5CPE 5COI 4HBX 4HBV 4NR8 5D24 4OGJ 2YEL 4MR4 4BW4 4MR3 3SVG 4HBW 5IGK 5DLZ 5D3H 5D3J 5D25 4O76 5JWM 5A85 4MEO 4J0R 4OGI 4HXP 5D3S 4ZW1 4HXO 4MEQ 5CP5 4O7F 3U5K 4MEN 5D26 4XY9 4LYS 4J0S 5FBX 4O7E 4MEP 4LZR 4C66 2OUO 5LJ1 5DLX 3UVX 4BW2 4E96 5D3T 5D3P 4LYW 3SVF 5CRM 4O77 4KV4 5AD2 5ACY 3UVY 4XYA 5CRZ 5D3N 5HLS 5D3R 4LZS 5EGU 4LRG 5DX4 3UW9 2YEM 5CTL 2ND1 2NCZ 2ND0 2N3K 2MJV 2LSP 2I8N
Thumbnails

Jmol
Position
19p13.1
AA seq 1362 aa AA seqDB search
MSAESGPGTRLRNLPVMGDGLETSQMSTTQAQAQPQPANAASTNPPPPETSNPNKPKRQT
NQLQYLLRVVLKTLWKHQFAWPFQQPVDAVKLNLPDYYKIIKTPMDMGTIKKRLENNYYW
NAQECIQDFNTMFTNCYIYNKPGDDIVLMAEALEKLFLQKINELPTEETEIMIVQAKGRG
RGRKETGTAKPGVSTVPNTTQASTPPQTQTPQPNPPPVQATPHPFPAVTPDLIVQTPVMT
VVPPQPLQTPPPVPPQPQPPPAPAPQPVQSHPPIIAATPQPVKTKKGVKRKADTTTPTTI
DPIHEPPSLPPEPKTTKLGQRRESSRPVKPPKKDVPDSQQHPAPEKSSKVSEQLKCCSGI
LKEMFAKKHAAYAWPFYKPVDVEALGLHDYCDIIKHPMDMSTIKSKLEAREYRDAQEFGA
DVRLMFSNCYKYNPPDHEVVAMARKLQDVFEMRFAKMPDEPEEPVVAVSSPAVPPPTKVV
APPSSSDSSSDSSSDSDSSTDDSEEERAQRLAELQEQLKAVHEQLAALSQPQQNKPKKKE
KDKKEKKKEKHKRKEEVEENKKSKAKEPPPKKTKKNNSSNSNVSKKEPAPMKSKPPPTYE
SEEEDKCKPMSYEEKRQLSLDINKLPGEKLGRVVHIIQSREPSLKNSNPDEIEIDFETLK
PSTLRELERYVTSCLRKKRKPQAEKVDVIAGSSKMKGFSSSESESSSESSSSDSEDSETE
MAPKSKKKGHPGREQKKHHHHHHQQMQQAPAPVPQQPPPPPQQPPPPPPPQQQQQPPPPP
PPPSMPQQAAPAMKSSPPPFIATQVPVLEPQLPGSVFDPIGHFTQPILHLPQPELPPHLP
QPPEHSTPPHLNQHAVVSPPALHNALPQQPSRPSNRAAALPPKPARPPAVSPALTQTPLL
PQPPMAQPPQVLLEDEEPPAPPLTSMQMQLYLQQLQKVQPPTPLLPSVKVQSQPPPPLPP
PPHPSVQQQLQQQPPPPPPPQPQPPPQQQHQPPPRPVHLQPMQFSTHIQQPPPPQGQQPP
HPPPGQQPPPPQPAKPQQVIQHHHSPRHHKSDPYSTGHLREAPSPLMIHSPQMSQFQSLT
HQSPPQQNVQPKKQELRAASVVQPQPLVVVKEEKIHSPIIRSEPFSPSLRPEPPKHPESI
KAPVHLPQRPEMKPVDVGRPVIRPPEQNAPPPGAPDKDKQKQEPKTPVAPKKDLKIKNMG
SWASLVQKHPTTPSSTAKSSSDSFEQFRRAAREKEEREKALKAQAEHAEKEKERLRQERM
RSREDEDALEQARRAHEEARRRQEQQQQQRQEQQQQQQQQAAAVAAAATPQAQSSQPQSM
LDQQRELARKREQERRRREAMAATIDMNFQSDLLSIFEENLF
NT seq 4089 nt NT seq  +upstreamnt  +downstreamnt
atgtctgcggagagcggccctgggacgagattgagaaatctgccagtaatgggggatgga
ctagaaacttcccaaatgtctacaacacaggcccaggcccaaccccagccagccaacgca
gccagcaccaaccccccgcccccagagacctccaaccctaacaagcccaagaggcagacc
aaccaactgcaatacctgctcagagtggtgctcaagacactatggaaacaccagtttgca
tggcctttccagcagcctgtggatgccgtcaagctgaacctccctgattactataagatc
attaaaacgcctatggatatgggaacaataaagaagcgcttggaaaacaactattactgg
aatgctcaggaatgtatccaggacttcaacactatgtttacaaattgttacatctacaac
aagcctggagatgacatagtcttaatggcagaagctctggaaaagctcttcttgcaaaaa
ataaatgagctacccacagaagaaaccgagatcatgatagtccaggcaaaaggaagagga
cgtgggaggaaagaaacagggacagcaaaacctggcgtttccacggtaccaaacacaact
caagcatcgactcctccgcagacccagacccctcagccgaatcctcctcctgtgcaggcc
acgcctcaccccttccctgccgtcaccccggacctcatcgtccagacccctgtcatgaca
gtggtgcctccccagccactgcagacgcccccgccagtgcccccccagccacaaccccca
cccgctccagctccccagcccgtacagagccacccacccatcatcgcggccaccccacag
cctgtgaagacaaagaagggagtgaagaggaaagcagacaccaccacccccaccaccatt
gaccccattcacgagccaccctcgctgcccccggagcccaagaccaccaagctgggccag
cggcgggagagcagccggcctgtgaaacctccaaagaaggacgtgcccgactctcagcag
cacccagcaccagagaagagcagcaaggtctcggagcagctcaagtgctgcagcggcatc
ctcaaggagatgtttgccaagaagcacgccgcctacgcctggcccttctacaagcctgtg
gacgtggaggcactgggcctacacgactactgtgacatcatcaagcaccccatggacatg
agcacaatcaagtctaaactggaggcccgtgagtaccgtgatgctcaggagtttggtgct
gacgtccgattgatgttctccaactgctataagtacaaccctcctgaccatgaggtggtg
gccatggcccgcaagctccaggatgtgttcgaaatgcgctttgccaagatgccggacgag
cctgaggagccagtggtggccgtgtcctccccggcagtgccccctcccaccaaggttgtg
gccccgccctcatccagcgacagcagcagcgatagctcctcggacagtgacagttcgact
gatgactctgaggaggagcgagcccagcggctggctgagctccaggagcagctcaaagcc
gtgcacgagcagcttgcagccctctctcagccccagcagaacaaaccaaagaaaaaggag
aaagacaagaaggaaaagaaaaaagaaaagcacaaaaggaaagaggaagtggaagagaat
aaaaaaagcaaagccaaggaacctcctcctaaaaagacgaagaaaaataatagcagcaac
agcaatgtgagcaagaaggagccagcgcccatgaagagcaagccccctcccacgtatgag
tcggaggaagaggacaagtgcaagcctatgtcctatgaggagaagcggcagctcagcttg
gacatcaacaagctccccggcgagaagctgggccgcgtggtgcacatcatccagtcacgg
gagccctccctgaagaattccaaccccgacgagattgaaatcgactttgagaccctgaag
ccgtccacactgcgtgagctggagcgctatgtcacctcctgtttgcggaagaaaaggaaa
cctcaagctgagaaagttgatgtgattgccggctcctccaagatgaagggcttctcgtcc
tcagagtcggagagctccagtgagtccagctcctctgacagcgaagactccgaaacagag
atggctccgaagtcaaaaaagaaggggcaccccgggagggagcagaagaagcaccatcat
caccaccatcagcagatgcagcaggccccggctcctgtgccccagcagccgcccccgcct
ccccagcagcccccaccgcctccacctccgcagcagcaacagcagccgccacccccgcct
cccccaccctccatgccgcagcaggcagccccggcgatgaagtcctcgcccccacccttc
attgccacccaggtgcccgtcctggagccccagctcccaggcagcgtctttgaccccatc
ggccacttcacccagcccatcctgcacctgccgcagcctgagctgccccctcacctgccc
cagccgcctgagcacagcactccaccccatctcaaccagcacgcagtggtctctcctcca
gctttgcacaacgcactaccccagcagccatcacggcccagcaaccgagccgctgccctg
cctcccaagcccgcccggcccccagccgtgtcaccagccttgacccaaacacccctgctc
ccacagccccccatggcccaacccccccaagtgctgctggaggatgaagagccacctgcc
ccacccctcacctccatgcagatgcagctgtacctgcagcagctgcagaaggtgcagccc
cctacgccgctactcccttccgtgaaggtgcagtcccagcccccaccccccctgccgccc
ccaccccacccctctgtgcagcagcagctgcagcagcagccgccaccacccccaccaccc
cagccccagcctccaccccagcagcagcatcagccccctccacggcccgtgcacttgcag
cccatgcagttttccacccacatccaacagcccccgccaccccagggccagcagcccccc
catccgcccccaggccagcagccacccccgccgcagcctgccaagcctcagcaagtcatc
cagcaccaccattcaccccggcaccacaagtcggacccctactcaaccggtcacctccgc
gaagccccctccccgcttatgatacattccccccagatgtcacagttccagagcctgacc
caccagtctccaccccagcaaaacgtccagcctaagaaacaggagctgcgtgctgcctcc
gtggtccagccccagcccctcgtggtggtgaaggaggagaagatccactcacccatcatc
cgcagcgagcccttcagcccctcgctgcggccggagccccccaagcacccggagagcatc
aaggcccccgtccacctgccccagcggccggaaatgaagcctgtggatgtcgggaggcct
gtgatccggcccccagagcagaacgcaccgccaccaggggcccctgacaaggacaaacag
aaacaggagccgaagactccagttgcgcccaaaaaggacctgaaaatcaagaacatgggc
tcctgggccagcctagtgcagaagcatccgaccaccccctcctccacagccaagtcatcc
agcgacagcttcgagcagttccgccgcgccgctcgggagaaagaggagcgtgagaaggcc
ctgaaggctcaggccgagcacgctgagaaggagaaggagcggctgcggcaggagcgcatg
aggagccgagaggacgaggatgcgctggagcaggcccggcgggcccatgaggaggcacgt
cggcgccaggagcagcagcagcagcagcgccaggagcaacagcagcagcagcaacagcaa
gcagctgcggtggctgccgccgccaccccacaggcccagagctcccagccccagtccatg
ctggaccagcagagggagttggcccggaagcgggagcaggagcgaagacgccgggaagcc
atggcagctaccattgacatgaatttccagagtgatctattgtcaatatttgaagaaaat
cttttctga

DBGET integrated database retrieval system