KEGG   Homo sapiens (human): 23478Help
Entry
23478             CDS       T01001                                 

Gene name
SEC11A, 1810012E07Rik, SEC11L1, SPC18, SPCS4A, sid2895
Definition
SEC11 homolog A (S. cerevisiae) (EC:3.4.21.89)
Orthology
K13280  
signal peptidase, endoplasmic reticulum-type [EC:3.4.-.-]
Organism
hsa  Homo sapiens (human)
Pathway
Protein export
Class
Genetic Information Processing; Folding, sorting and degradation; Protein export [PATH:hsa03060]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
15q25.3
AA seq 153 aa AA seqDB search
MIVSSALMIWKGLMVITGSESPIVVVLSGSMEPAFHRGDLLFLTNRVEDPIRVGEIVVFR
IEGREIPIVHRVLKIHEKQNGHIKFLTKGDNNAVDDRGLYKQGQHWLEKKDVVGRARGFV
PYIGIVTILMNDYPKFKYAVLFLLGLFVLVHRE
NT seq 462 nt NT seq  +upstreamnt  +downstreamnt
atgattgtctcatcggcactaatgatctggaaggggttaatggtaataactggaagtgaa
agtccgattgtagtggtgctcagtggcagcatggaacctgcatttcatagaggagatctt
ctctttctaacaaatcgagttgaagatcccatacgagtgggagaaattgttgtttttagg
atagaaggaagagagattcctatagttcaccgagtcttgaagattcatgaaaagcaaaat
gggcatatcaagtttttgaccaaaggagataataatgcggttgatgaccgaggcctctat
aaacaaggacaacattggctagagaaaaaagatgttgtggggagagccaggggatttgtt
ccttatattggaattgtgacgatcctcatgaatgactatcctaaatttaagtatgcagtt
ctctttttgctgggtttattcgtgctggttcatcgtgagtaa

DBGET integrated database retrieval system