KEGG   Homo sapiens (human): 2348Help
Entry
2348              CDS       T01001                                 

Gene name
FOLR1, FBP, FOLR
Definition
(RefSeq) folate receptor 1
  KO
K13649  
folate receptor
Organism
hsa  Homo sapiens (human)
Pathway
Antifolate resistance
Endocytosis
Disease
H01295  
Neurodegeneration due to cerebral folate transport deficiency
Drug target
Farletuzumab: 
Vintafolide: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    2348 (FOLR1)
 Human Diseases
  Drug resistance
   01523 Antifolate resistance
    2348 (FOLR1)
Transporters [BR:hsa02000]
 Other Transporters
  Others
   2348 (FOLR1)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   2348 (FOLR1)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:hsa00537]
 Receptors
  2348 (FOLR1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
Pharos: 
P15328(Tchem)
UniProt: 
Structure
PDB: 

Jmol
Position
11q13.4
AA seq 257 aa AA seqDB search
MAQRMTTQLLLLLVWVAVVGEAQTRIAWARTELLNVCMNAKHHKEKPGPEDKLHEQCRPW
RKNACCSTNTSQEAHKDVSYLYRFNWNHCGEMAPACKRHFIQDTCLYECSPNLGPWIQQV
DQSWRKERVLNVPLCKEDCEQWWEDCRTSYTCKSNWHKGWNWTSGFNKCAVGAACQPFHF
YFPTPTVLCNEIWTHSYKVSNYSRGSGRCIQMWFDPAQGNPNEEVARFYAAAMSGAGPWA
AWPFLLSLALMLLWLLS
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atggctcagcggatgacaacacagctgctgctccttctagtgtgggtggctgtagtaggg
gaggctcagacaaggattgcatgggccaggactgagcttctcaatgtctgcatgaacgcc
aagcaccacaaggaaaagccaggccccgaggacaagttgcatgagcagtgtcgaccctgg
aggaagaatgcctgctgttctaccaacaccagccaggaagcccataaggatgtttcctac
ctatatagattcaactggaaccactgtggagagatggcacctgcctgcaaacggcatttc
atccaggacacctgcctctacgagtgctcccccaacttggggccctggatccagcaggtg
gatcagagctggcgcaaagagcgggtactgaacgtgcccctgtgcaaagaggactgtgag
caatggtgggaagattgtcgcacctcctacacctgcaagagcaactggcacaagggctgg
aactggacttcagggtttaacaagtgcgcagtgggagctgcctgccaacctttccatttc
tacttccccacacccactgttctgtgcaatgaaatctggactcactcctacaaggtcagc
aactacagccgagggagtggccgctgcatccagatgtggttcgacccagcccagggcaac
cccaatgaggaggtggcgaggttctatgctgcagccatgagtggggctgggccctgggca
gcctggcctttcctgcttagcctggccctaatgctgctgtggctgctcagctga

KEGG   Homo sapiens (human): 2350Help
Entry
2350              CDS       T01001                                 

Gene name
FOLR2, BETA-HFR, FBP, FBP/PL-1, FR-BETA, FR-P3
Definition
(RefSeq) folate receptor beta
  KO
K13649  
folate receptor
Organism
hsa  Homo sapiens (human)
Pathway
Antifolate resistance
Endocytosis
Drug target
Vintafolide: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    2350 (FOLR2)
 Human Diseases
  Drug resistance
   01523 Antifolate resistance
    2350 (FOLR2)
Transporters [BR:hsa02000]
 Other Transporters
  Others
   2350 (FOLR2)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   2350 (FOLR2)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:hsa00537]
 Receptors
  2350 (FOLR2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
Pharos: 
P14207(Tchem)
UniProt: 
Structure
PDB: 

Jmol
Position
11q13.4
AA seq 255 aa AA seqDB search
MVWKWMPLLLLLVCVATMCSAQDRTDLLNVCMDAKHHKTKPGPEDKLHDQCSPWKKNACC
TASTSQELHKDTSRLYNFNWDHCGKMEPACKRHFIQDTCLYECSPNLGPWIQQVNQSWRK
ERFLDVPLCKEDCQRWWEDCHTSHTCKSNWHRGWDWTSGVNKCPAGALCRTFESYFPTPA
ALCEGLWSHSYKVSNYSRGSGRCIQMWFDSAQGNPNEEVARFYAAAMHVNAGEMLHGTGG
LLLSLALMLQLWLLG
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atggtctggaaatggatgccacttctgctgcttctggtctgtgtagccaccatgtgcagt
gcccaggacaggactgatctcctcaatgtctgtatggatgccaagcaccacaagacaaag
ccaggtcctgaggacaagctgcatgaccaatgcagtccctggaagaagaatgcctgctgc
acagccagcaccagccaggagctgcacaaggacacctcccgcctgtacaactttaactgg
gaccactgcggcaagatggagcccgcctgcaagcgccacttcatccaggacacctgtctc
tatgagtgctcacccaacctggggccctggatccagcaggtgaatcagagctggcgcaaa
gaacgcttcctggatgtgcccttatgcaaagaggactgtcagcgctggtgggaggattgt
cacacctcccacacgtgcaagagcaactggcacagaggatgggactggacctcaggagtt
aacaagtgcccagctggggctctctgccgcacctttgagtcctacttccccactccagct
gccctttgtgaaggcctctggagtcactcatacaaggtcagcaactacagccgagggagc
ggccgctgcatccagatgtggtttgattcagcccagggcaaccccaacgaggaagtggcg
aggttctatgctgcagccatgcatgtgaatgctggtgagatgcttcatgggactgggggt
ctcctgctcagtctggccctgatgctgcaactctggctccttggctga

KEGG   Homo sapiens (human): 2352Help
Entry
2352              CDS       T01001                                 

Gene name
FOLR3, FR-G, FR-gamma, gamma-hFR
Definition
(RefSeq) folate receptor 3
  KO
K13649  
folate receptor
Organism
hsa  Homo sapiens (human)
Pathway
Antifolate resistance
Endocytosis
Drug target
Vintafolide: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    2352 (FOLR3)
 Human Diseases
  Drug resistance
   01523 Antifolate resistance
    2352 (FOLR3)
Transporters [BR:hsa02000]
 Other Transporters
  Others
   2352 (FOLR3)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   2352 (FOLR3)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:hsa00537]
 Receptors
  2352 (FOLR3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
Pharos: 
P41439(Tdark)
UniProt: 
Position
11q13.4
AA seq 245 aa AA seqDB search
MDMAWQMMQLLLLALVTAAGSAQPRSARARTDLLNVCMNAKHHKTQPSPEDELYGQCSPW
KKNACCTASTSQELHKDTSRLYNFNWDHCGKMEPTCKRHFIQDSCLYECSPNLGPWIRQV
NQSWRKERILNVPLCKEDCERWWEDCRTSYTCKSNWHKGWNWTSGINECPAGALCSTFES
YFPTPAALCEGLWSHSFKVSNYSRGSGRCIQMWFDSAQGNPNEEVAKFYAAAMNAGAPSR
GIIDS
NT seq 738 nt NT seq  +upstreamnt  +downstreamnt
atggacatggcctggcagatgatgcagctgctgcttctggctttggtgactgctgcgggg
agtgcccagcccaggagtgcgcgggccaggacggacctgctcaatgtctgcatgaacgcc
aagcaccacaagacacagcccagccccgaggacgagctgtatggccagtgcagtccctgg
aagaagaatgcctgctgcacggccagcaccagccaggagctgcacaaggacacctcccgc
ctgtacaactttaactgggatcactgtggtaagatggaacccacctgcaagcgccacttt
atccaggacagctgtctctatgagtgctcacccaacctggggccctggatccggcaggtc
aaccagagctggcgcaaagagcgcattctgaacgtgcccctgtgcaaagaggactgtgag
cgctggtgggaggactgtcgcacctcctacacctgcaaaagcaactggcacaaaggctgg
aattggacctcagggattaatgagtgtccggccggggccctctgcagcacctttgagtcc
tacttccccactccagccgccctttgtgaaggcctctggagccactccttcaaggtcagc
aactatagtcgagggagcggccgctgcatccagatgtggtttgactcagcccagggcaac
cccaatgaggaggtggccaagttctatgctgcggccatgaatgctggggccccgtctcgt
gggattattgattcctga

KEGG   Homo sapiens (human): 390243Help
Entry
390243            CDS       T01001                                 

Gene name
IZUMO1R, FOLR4, Folbp3, JUNO
Definition
(RefSeq) IZUMO1 receptor, JUNO
  KO
K13649  
folate receptor
Organism
hsa  Homo sapiens (human)
Pathway
Antifolate resistance
Endocytosis
Drug target
Vintafolide: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    390243 (IZUMO1R)
 Human Diseases
  Drug resistance
   01523 Antifolate resistance
    390243 (IZUMO1R)
Transporters [BR:hsa02000]
 Other Transporters
  Others
   390243 (IZUMO1R)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   390243 (IZUMO1R)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:hsa00537]
 Receptors
  390243 (IZUMO1R)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
A6ND01(Tbio)
UniProt: 
Structure
PDB: 

Jmol
Position
11q21
AA seq 250 aa AA seqDB search
MACWWPLLLELWTVMPTWAGDELLNICMNAKHHKRVPSPEDKLYEECIPWKDNACCTLTT
SWEAHLDVSPLYNFSLFHCGLLMPGCRKHFIQAICFYECSPNLGPWIQPVGSLGWEVAPS
GQGERVVNVPLCQEDCEEWWEDCRMSYTCKSNWRGGWDWSQGKNRCPKGAQCLPFSHYFP
TPADLCEKTWSNSFKASPERRNSGRCLQKWFEPAQGNPNVAVARLFASSAPSWELSYTIM
VCSLFLPFLS
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atggcatgctggtggccgctcctgctagagctgtggacagtcatgcccacctgggctggg
gacgagctgctcaacatctgcatgaatgccaaacaccacaagagagtgcccagcccagaa
gacaagctctatgaggagtgcatcccctggaaggacaatgcctgctgcaccctcacgaca
agctgggaagcccatctggatgtatccccactctacaacttcagcctgtttcactgtgga
ctgctgatgcctggctgtcggaagcacttcatccaggctatctgcttctatgagtgctcc
ccaaacctggggccctggatccagccagtgggaagcctggggtgggaggtggccccgagt
gggcagggagagcgagttgtgaatgtgccgctgtgccaggaggactgtgaggagtggtgg
gaagactgtcgcatgtcttacacatgcaaatccaactggcgtggtggctgggactggagt
caggggaagaaccgctgccccaaaggggcccagtgcctccctttctcccattacttcccc
accccagctgacctgtgtgagaagacttggagcaattccttcaaagccagccctgagcga
cggaacagtgggcggtgtctccagaagtggtttgagcctgctcagggcaaccccaatgtg
gccgtggcccgcctcttcgccagctctgccccatcctgggaactgtcctacaccatcatg
gtctgctccctgttcctgccgttcctttcctga

DBGET integrated database retrieval system