KEGG   Homo sapiens (human): 2348Help
Entry
2348              CDS       T01001                                 

Gene name
FOLR1, FBP, FOLR
Definition
folate receptor 1 (adult)
Orthology
K13649  
folate receptor
Organism
hsa  Homo sapiens (human)
Pathway
Endocytosis
Disease
H01295  
Neurodegeneration due to cerebral folate transport deficiency
Drug target
Vintafolide: 
Other: 
Class
Cellular Processes; Transport and catabolism; Endocytosis [PATH:hsa04144]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
11q13.3-q14.1
AA seq 257 aa AA seqDB search
MAQRMTTQLLLLLVWVAVVGEAQTRIAWARTELLNVCMNAKHHKEKPGPEDKLHEQCRPW
RKNACCSTNTSQEAHKDVSYLYRFNWNHCGEMAPACKRHFIQDTCLYECSPNLGPWIQQV
DQSWRKERVLNVPLCKEDCEQWWEDCRTSYTCKSNWHKGWNWTSGFNKCAVGAACQPFHF
YFPTPTVLCNEIWTHSYKVSNYSRGSGRCIQMWFDPAQGNPNEEVARFYAAAMSGAGPWA
AWPFLLSLALMLLWLLS
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atggctcagcggatgacaacacagctgctgctccttctagtgtgggtggctgtagtaggg
gaggctcagacaaggattgcatgggccaggactgagcttctcaatgtctgcatgaacgcc
aagcaccacaaggaaaagccaggccccgaggacaagttgcatgagcagtgtcgaccctgg
aggaagaatgcctgctgttctaccaacaccagccaggaagcccataaggatgtttcctac
ctatatagattcaactggaaccactgtggagagatggcacctgcctgcaaacggcatttc
atccaggacacctgcctctacgagtgctcccccaacttggggccctggatccagcaggtg
gatcagagctggcgcaaagagcgggtactgaacgtgcccctgtgcaaagaggactgtgag
caatggtgggaagattgtcgcacctcctacacctgcaagagcaactggcacaagggctgg
aactggacttcagggtttaacaagtgcgcagtgggagctgcctgccaacctttccatttc
tacttccccacacccactgttctgtgcaatgaaatctggactcactcctacaaggtcagc
aactacagccgagggagtggccgctgcatccagatgtggttcgacccagcccagggcaac
cccaatgaggaggtggcgaggttctatgctgcagccatgagtggggctgggccctgggca
gcctggcctttcctgcttagcctggccctaatgctgctgtggctgctcagctga

KEGG   Homo sapiens (human): 2350Help
Entry
2350              CDS       T01001                                 

Gene name
FOLR2, BETA-HFR, FBP, FBP/PL-1, FR-BETA, FR-P3
Definition
folate receptor 2 (fetal)
Orthology
K13649  
folate receptor
Organism
hsa  Homo sapiens (human)
Pathway
Endocytosis
Drug target
Vintafolide: 
Class
Cellular Processes; Transport and catabolism; Endocytosis [PATH:hsa04144]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
11q13.3-q13.5
AA seq 255 aa AA seqDB search
MVWKWMPLLLLLVCVATMCSAQDRTDLLNVCMDAKHHKTKPGPEDKLHDQCSPWKKNACC
TASTSQELHKDTSRLYNFNWDHCGKMEPACKRHFIQDTCLYECSPNLGPWIQQVNQSWRK
ERFLDVPLCKEDCQRWWEDCHTSHTCKSNWHRGWDWTSGVNKCPAGALCRTFESYFPTPA
ALCEGLWSHSYKVSNYSRGSGRCIQMWFDSAQGNPNEEVARFYAAAMHVNAGEMLHGTGG
LLLSLALMLQLWLLG
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atggtctggaaatggatgccacttctgctgcttctggtctgtgtagccaccatgtgcagt
gcccaggacaggactgatctcctcaatgtctgtatggatgccaagcaccacaagacaaag
ccaggtcctgaggacaagctgcatgaccaatgcagtccctggaagaagaatgcctgctgc
acagccagcaccagccaggagctgcacaaggacacctcccgcctgtacaactttaactgg
gaccactgcggcaagatggagcccgcctgcaagcgccacttcatccaggacacctgtctc
tatgagtgctcacccaacctggggccctggatccagcaggtgaatcagagctggcgcaaa
gaacgcttcctggatgtgcccttatgcaaagaggactgtcagcgctggtgggaggattgt
cacacctcccacacgtgcaagagcaactggcacagaggatgggactggacctcaggagtt
aacaagtgcccagctggggctctctgccgcacctttgagtcctacttccccactccagct
gccctttgtgaaggcctctggagtcactcatacaaggtcagcaactacagccgagggagc
ggccgctgcatccagatgtggtttgattcagcccagggcaaccccaacgaggaagtggcg
aggttctatgctgcagccatgcatgtgaatgctggtgagatgcttcatgggactgggggt
ctcctgctcagtctggccctgatgctgcaactctggctccttggctga

KEGG   Homo sapiens (human): 2352Help
Entry
2352              CDS       T01001                                 

Gene name
FOLR3, FR-G, FR-gamma, gamma-hFR
Definition
folate receptor 3 (gamma)
Orthology
K13649  
folate receptor
Organism
hsa  Homo sapiens (human)
Pathway
Endocytosis
Drug target
Vintafolide: 
Class
Cellular Processes; Transport and catabolism; Endocytosis [PATH:hsa04144]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
11q13
AA seq 245 aa AA seqDB search
MDMAWQMMQLLLLALVTAAGSAQPRSARARTDLLNVCMNAKHHKTQPSPEDELYGQCSPW
KKNACCTASTSQELHKDTSRLYNFNWDHCGKMEPTCKRHFIQDSCLYECSPNLGPWIRQV
NQSWRKERILNVPLCKEDCERWWEDCRTSYTCKSNWHKGWNWTSGINECPAGALCSTFES
YFPTPAALCEGLWSHSFKVSNYSRGSGRCIQMWFDSAQGNPNEEVAKFYAAAMNAGAPSR
GIIDS
NT seq 738 nt NT seq  +upstreamnt  +downstreamnt
atggacatggcctggcagatgatgcagctgctgcttctggctttggtgactgctgcgggg
agtgcccagcccaggagtgcgcgggccaggacggacctgctcaatgtctgcatgaacgcc
aagcaccacaagacacagcccagccccgaggacgagctgtatggccagtgcagtccctgg
aagaagaatgcctgctgcacggccagcaccagccaggagctgcacaaggacacctcccgc
ctgtacaactttaactgggatcactgtggtaagatggaacccacctgcaagcgccacttt
atccaggacagctgtctctatgagtgctcacccaacctggggccctggatccggcaggtc
aaccagagctggcgcaaagagcgcattctgaacgtgcccctgtgcaaagaggactgtgag
cgctggtgggaggactgtcgcacctcctacacctgcaaaagcaactggcacaaaggctgg
aattggacctcagggattaatgagtgtccggccggggccctctgcagcacctttgagtcc
tacttccccactccagccgccctttgtgaaggcctctggagccactccttcaaggtcagc
aactatagtcgagggagcggccgctgcatccagatgtggtttgactcagcccagggcaac
cccaatgaggaggtggccaagttctatgctgcggccatgaatgctggggccccgtctcgt
gggattattgattcctga

KEGG   Homo sapiens (human): 390243Help
Entry
390243            CDS       T01001                                 

Gene name
FOLR4, Folbp3
Definition
folate receptor 4, delta (putative)
Orthology
K13649  
folate receptor
Organism
hsa  Homo sapiens (human)
Pathway
Endocytosis
Drug target
Vintafolide: 
Class
Cellular Processes; Transport and catabolism; Endocytosis [PATH:hsa04144]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
HGNC: 
Ensembl: 
Vega: 
UniProt: 
Position
11q21
AA seq 250 aa AA seqDB search
MACWWPLLLELWTVMPTWAGDELLNICMNAKHHKRVPSPEDKLYEECIPWKDNACCTLTT
SWEAHLDVSPLYNFSLFHCGLLMPGCRKHFIQAICFYECSPNLGPWIQPVGSLGWEVAPS
GQGERVVNVPLCQEDCEEWWEDCRMSYTCKSNWRGGWDWSQGKNRCPKGAQCLPFSHYFP
TPADLCEKTWSNSFKASPERRNSGRCLQKWFEPAQGNPNVAVARLFASSAPSWELSYTIM
VCSLFLPFLS
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atggcatgctggtggccgctcctgctagagctgtggacagtcatgcccacctgggctggg
gacgagctgctcaacatctgcatgaatgccaaacaccacaagagagtgcccagcccagaa
gacaagctctatgaggagtgcatcccctggaaggacaatgcctgctgcaccctcacgaca
agctgggaagcccatctggatgtatccccactctacaacttcagcctgtttcactgtgga
ctgctgatgcctggctgtcggaagcacttcatccaggctatctgcttctatgagtgctcc
ccaaacctggggccctggatccagccagtgggaagcctggggtgggaggtggccccgagt
gggcagggagagcgagttgtgaatgtgccgctgtgccaggaggactgtgaggagtggtgg
gaagactgtcgcatgtcttacacatgcaaatccaactggcgtggtggctgggactggagt
caggggaagaaccgctgccccaaaggggcccagtgcctccctttctcccattacttcccc
accccagctgacctgtgtgagaagacttggagcaattccttcaaagccagccctgagcga
cggaacagtgggcggtgtctccagaagtggtttgagcctgctcagggcaaccccaatgtg
gccgtggcccgcctcttcgccagctctgccccatcctgggaactgtcctacaccatcatg
gtctgctccctgttcctgccgttcctttcctga

DBGET integrated database retrieval system