KEGG   Homo sapiens (human): 23483Help
Entry
23483             CDS       T01001                                 

Gene name
TGDS, CATMANS, SDR2E1, TDPGD
Definition
(RefSeq) TDP-glucose 4,6-dehydratase
  KO
K01710  dTDP-glucose 4,6-dehydratase [EC:4.2.1.46]
Organism
hsa  Homo sapiens (human)
Disease
H01845  Catel-Manzke syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    23483 (TGDS)
   01055 Biosynthesis of vancomycin group antibiotics
    23483 (TGDS)
  Biosynthesis of other secondary metabolites
   00525 Acarbose and validamycin biosynthesis
    23483 (TGDS)
Enzymes [BR:hsa01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.46  dTDP-glucose 4,6-dehydratase
     23483 (TGDS)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GDP_Man_Dehyd Epimerase 3Beta_HSD Polysacc_synt_2 RmlD_sub_bind NAD_binding_4 NAD_binding_10 adh_short
Motif
Other DBs
NCBI-GeneID: 23483
NCBI-ProteinID: NP_055120
OMIM: 616146
HGNC: 20324
Ensembl: ENSG00000088451
Vega: OTTHUMG00000046308
Pharos: O95455(Tbio)
UniProt: O95455
Position
13q32.1
AA seq 350 aa AA seqDB search
MSAACWEEPWGLPGGFAKRVLVTGGAGFIASHMIVSLVEDYPNYMIINLDKLDYCASLKN
LETISNKQNYKFIQGDICDSHFVKLLFETEKIDIVLHFAAQTHVDLSFVRAFEFTYVNVY
GTHVLVSAAHEARVEKFIYVSTDEVYGGSLDKEFDESSPKQPTNPYASSKAAAECFVQSY
WEQYKFPVVITRSSNVYGPHQYPEKVIPKFISLLQHNRKCCIHGSGLQTRNFLYATDVVE
AFLTVLKKGKPGEIYNIGTNFEMSVVQLAKELIQLIKETNSESEMENWVDYVNDRPTNDM
RYPMKSEKIHGLGWRPKVPWKEGIKKTIEWYRENFHNWKNVEKALEPFPV
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atgtcggcggcgtgttgggaggaaccgtggggtcttcccggcggctttgcgaagcgggtc
ctggtgaccggcggtgctggtttcattgcatcacatatgattgtctctttagtggaagat
tatccaaactatatgatcataaatctagacaagctggattactgtgcaagcttgaagaat
cttgaaaccatttctaacaaacagaactacaaatttatacagggtgacatatgtgattct
cactttgtgaaactgctttttgaaacagagaaaatagatatagtactacattttgccgca
caaacacatgtagatctttcattcgtacgtgcctttgagtttacctatgttaatgtttat
ggcactcacgttttggtaagtgctgctcatgaagccagagtggagaagtttatttatgtc
agcacagatgaagtatatggtggcagtcttgataaggaatttgatgaatcttcacccaaa
caacctacaaatccttatgcatcatctaaagcagctgctgaatgttttgtacagtcttac
tgggaacaatataagtttccagttgtcatcacaagaagcagtaatgtttatggaccacat
caatatccagaaaaggttattccaaaatttatatctttgctacagcacaacaggaaatgt
tgcattcatgggtcagggcttcaaacaagaaacttcctttatgctactgatgttgtagaa
gcatttctcactgtcctcaaaaaagggaaaccaggtgaaatttataacatcggaaccaat
tttgaaatgtcagttgtccagcttgccaaagaactaatacaactgatcaaagagaccaat
tcagagtctgaaatggaaaattgggttgattatgttaatgatagacccaccaatgacatg
agatacccaatgaagtcagaaaaaatacatggcttaggatggagacctaaagtgccttgg
aaagaaggaataaagaaaacaattgaatggtacagagagaattttcacaactggaagaat
gtggaaaaggcattagaaccctttccggtataa

DBGET integrated database retrieval system