KEGG   Homo sapiens (human): 23483Help
Entry
23483             CDS       T01001                                 

Gene name
TGDS, CATMANS, SDR2E1, TDPGD
Definition
(RefSeq) TDP-glucose 4,6-dehydratase (EC:4.2.1.46)
  KO
K01710  
dTDP-glucose 4,6-dehydratase [EC:4.2.1.46]
Organism
hsa  Homo sapiens (human)
Pathway
Metabolic pathways
Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    23483 (TGDS)
   01055 Biosynthesis of vancomycin group antibiotics
    23483 (TGDS)
Enzymes [BR:hsa01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.46  dTDP-glucose 4,6-dehydratase
     23483 (TGDS)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
13q32.1
AA seq 318 aa AA seqDB search
MIVSLVEDYPNYMIINLDKLDYCASLKNLETISNKQNYKFIQGDICDSHFVKLLFETEKI
DIVLHFAAQTHVDLSFVRAFEFTYVNVYGTHVLVSAAHEARVEKFIYVSTDEVYGGSLDK
EFDESSPKQPTNPYASSKAAAECFVQSYWEQYKFPVVITRSSNVYGPHQYPEKVIPKFIS
LLQHNRKCCIHGSGLQTRNFLYATDVVEAFLTVLKKGKPGEIYNIGTNFEMSVVQLAKEL
IQLIKETNSESEMENWVDYVNDRPTNDMRYPMKSEKIHGLGWRPKVPWKEGIKKTIEWYR
ENFHNWKNVEKALEPFPV
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
atgattgtctctttagtggaagattatccaaactatatgatcataaatctagacaagctg
gattactgtgcaagcttgaagaatcttgaaaccatttctaacaaacagaactacaaattt
atacagggtgacatatgtgattctcactttgtgaaactgctttttgaaacagagaaaata
gatatagtactacattttgccgcacaaacacatgtagatctttcattcgtacgtgccttt
gagtttacctatgttaatgtttatggcactcacgttttggtaagtgctgctcatgaagcc
agagtggagaagtttatttatgtcagcacagatgaagtatatggtggcagtcttgataag
gaatttgatgaatcttcacccaaacaacctacaaatccttatgcatcatctaaagcagct
gctgaatgttttgtacagtcttactgggaacaatataagtttccagttgtcatcacaaga
agcagtaatgtttatggaccacatcaatatccagaaaaggttattccaaaatttatatct
ttgctacagcacaacaggaaatgttgcattcatgggtcagggcttcaaacaagaaacttc
ctttatgctactgatgttgtagaagcatttctcactgtcctcaaaaaagggaaaccaggt
gaaatttataacatcggaaccaattttgaaatgtcagttgtccagcttgccaaagaacta
atacaactgatcaaagagaccaattcagagtctgaaatggaaaattgggttgattatgtt
aatgatagacccaccaatgacatgagatacccaatgaagtcagaaaaaatacatggctta
ggatggagacctaaagtgccttggaaagaaggaataaagaaaacaattgaatggtacaga
gagaattttcacaactggaagaatgtggaaaaggcattagaaccctttccggtataa

DBGET integrated database retrieval system