KEGG   Homo sapiens (human): 23483Help
Entry
23483             CDS       T01001                                 

Gene name
TGDS, SDR2E1, TDPGD
Definition
TDP-glucose 4,6-dehydratase (EC:4.2.1.46)
Orthology
K01710  
dTDP-glucose 4,6-dehydratase [EC:4.2.1.46]
Organism
hsa  Homo sapiens (human)
Pathway
Metabolic pathways
Class
Metabolism; Metabolism of terpenoids and polyketides; Polyketide sugar unit biosynthesis
Metabolism; Metabolism of terpenoids and polyketides; Biosynthesis of vancomycin group antibiotics
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
13q32.1
AA seq 350 aa AA seqDB search
MSAACWEEPWGLPGGFAKRVLVTGGAGFIASHMIVSLVEDYPNYMIINLDKLDYCASLKN
LETISNKQNYKFIQGDICDSHFVKLLFETEKIDIVLHFAAQTHVDLSFVRAFEFTYVNVY
GTHVLVSAAHEARVEKFIYVSTDEVYGGSLDKEFDESSPKQPTNPYASSKAAAECFVQSY
WEQYKFPVVITRSSNVYGPHQYPEKVIPKFISLLQHNRKCCIHGSGLQTRNFLYATDVVE
AFLTVLKKGKPGEIYNIGTNFEMSVVQLAKELIQLIKETNSESEMENWVDYVNDRPTNDM
RYPMKSEKIHGLGWRPKVPWKEGIKKTIEWYRENFHNWKNVEKALEPFPV
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atgtcggcggcgtgttgggaggaaccgtggggtcttcccggcggctttgcgaagcgggtc
ctggtgaccggcggtgctggtttcattgcatcacatatgattgtctctttagtggaagat
tatccaaactatatgatcataaatctagacaagctggattactgtgcaagcttgaagaat
cttgaaaccatttctaacaaacagaactacaaatttatacagggtgacatatgtgattct
cactttgtgaaactgctttttgaaacagagaaaatagatatagtactacattttgccgca
caaacacatgtagatctttcattcgtacgtgcctttgagtttacctatgttaatgtttat
ggcactcacgttttggtaagtgctgctcatgaagccagagtggagaagtttatttatgtc
agcacagatgaagtatatggtggcagtcttgataaggaatttgatgaatcttcacccaaa
caacctacaaatccttatgcatcatctaaagcagctgctgaatgttttgtacagtcttac
tgggaacaatataagtttccagttgtcatcacaagaagcagtaatgtttatggaccacat
caatatccagaaaaggttattccaaaatttatatctttgctacagcacaacaggaaatgt
tgcattcatgggtcagggcttcaaacaagaaacttcctttatgctactgatgttgtagaa
gcatttctcactgtcctcaaaaaagggaaaccaggtgaaatttataacatcggaaccaat
tttgaaatgtcagttgtccagcttgccaaagaactaatacaactgatcaaagagaccaat
tcagagtctgaaatggaaaattgggttgattatgttaatgatagacccaccaatgacatg
agatacccaatgaagtcagaaaaaatacatggcttaggatggagacctaaagtgccttgg
aaagaaggaataaagaaaacaattgaatggtacagagagaattttcacaactggaagaat
gtggaaaaggcattagaaccctttccggtataa

DBGET integrated database retrieval system