KEGG   Homo sapiens (human): 23483Help
Entry
23483             CDS       T01001                                 

Gene name
TGDS, CATMANS, SDR2E1, TDPGD
Definition
(RefSeq) TDP-glucose 4,6-dehydratase (EC:4.2.1.46)
  KO
K01710  
dTDP-glucose 4,6-dehydratase [EC:4.2.1.46]
Organism
hsa  Homo sapiens (human)
Pathway
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    23483 (TGDS)
   01055 Biosynthesis of vancomycin group antibiotics
    23483 (TGDS)
  Biosynthesis of other secondary metabolites
   00525 Acarbose and validamycin biosynthesis
    23483 (TGDS)
Enzymes [BR:hsa01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.46  dTDP-glucose 4,6-dehydratase
     23483 (TGDS)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
13q32.1
AA seq 350 aa AA seqDB search
MSAACWEEPWGLPGGFAKRVLVTGGAGFIASHMIVSLVEDYPNYMIINLDKLDYCASLKN
LETISNKQNYKFIQGDICDSHFVKLLFETEKIDIVLHFAAQTHVDLSFVRAFEFTYVNVY
GTHVLVSAAHEARVEKFIYVSTDEVYGGSLDKEFDESSPKQPTNPYASSKAAAECFVQSY
WEQYKFPVVITRSSNVYGPHQYPEKVIPKFISLLQHNRKCCIHGSGLQTRNFLYATDVVE
AFLTVLKKGKPGEIYNIGTNFEMSVVQLAKELIQLIKETNSESEMENWVDYVNDRPTNDM
RYPMKSEKIHGLGWRPKVPWKEGIKKTIEWYRENFHNWKNVEKALEPFPV
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atgtcggcggcgtgttgggaggaaccgtggggtcttcccggcggctttgcgaagcgggtc
ctggtgaccggcggtgctggtttcattgcatcacatatgattgtctctttagtggaagat
tatccaaactatatgatcataaatctagacaagctggattactgtgcaagcttgaagaat
cttgaaaccatttctaacaaacagaactacaaatttatacagggtgacatatgtgattct
cactttgtgaaactgctttttgaaacagagaaaatagatatagtactacattttgccgca
caaacacatgtagatctttcattcgtacgtgcctttgagtttacctatgttaatgtttat
ggcactcacgttttggtaagtgctgctcatgaagccagagtggagaagtttatttatgtc
agcacagatgaagtatatggtggcagtcttgataaggaatttgatgaatcttcacccaaa
caacctacaaatccttatgcatcatctaaagcagctgctgaatgttttgtacagtcttac
tgggaacaatataagtttccagttgtcatcacaagaagcagtaatgtttatggaccacat
caatatccagaaaaggttattccaaaatttatatctttgctacagcacaacaggaaatgt
tgcattcatgggtcagggcttcaaacaagaaacttcctttatgctactgatgttgtagaa
gcatttctcactgtcctcaaaaaagggaaaccaggtgaaatttataacatcggaaccaat
tttgaaatgtcagttgtccagcttgccaaagaactaatacaactgatcaaagagaccaat
tcagagtctgaaatggaaaattgggttgattatgttaatgatagacccaccaatgacatg
agatacccaatgaagtcagaaaaaatacatggcttaggatggagacctaaagtgccttgg
aaagaaggaataaagaaaacaattgaatggtacagagagaattttcacaactggaagaat
gtggaaaaggcattagaaccctttccggtataa

DBGET integrated database retrieval system