KEGG   Homo sapiens (human): 23491Help
Entry
23491             CDS       T01001                                 

Gene name
CES3, ES31
Definition
carboxylesterase 3 (EC:3.1.1.1)
Orthology
K15743  
carboxylesterase 3/5 [EC:3.1.1.1]
Organism
hsa  Homo sapiens (human)
Brite
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     23491 (CES3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
16q22.1
AA seq 210 aa AA seqDB search
MEQMSREDMLAISTPVLTSLDVPPEMMPTVIDEYLGSNSDAQAKCQAFQEFMGDVFINVP
TVSFSRYLRDSGSPVFFYEFQHRPSSFAKIKPAWVKADHGAEGAFVFGGPFLMDESSRLA
FPEATEEEKQLSLTMMAQWTHFARTGDPNSKALPPWPQFNQAEQYLEINPVPRAGQKFRE
AWMQFWSETLPSKIQQWHQKQKNRKAQEDL
NT seq 633 nt NT seq  +upstreamnt  +downstreamnt
atggagcagatgagccgggaggacatgctggccatctcaacacccgtcttgaccagtctg
gatgtgccccctgagatgatgcccaccgtcatagatgaatacctaggaagcaactcggac
gcacaagccaaatgccaggcgttccaggaattcatgggtgacgtattcatcaatgttccc
accgtcagtttttcaagataccttcgagattctggaagccctgtctttttctatgagttc
cagcatcgacccagttcttttgcgaagatcaaacctgcctgggtgaaggctgatcatggg
gccgagggtgcttttgtgttcggaggtcccttcctcatggacgagagctcccgcctggcc
tttccagaggccacagaggaggagaagcagctaagcctcaccatgatggcccagtggacc
cactttgcccggacaggggaccccaatagcaaggctctgcctccttggccccaattcaac
caggcggaacaatatctggagatcaacccagtgccacgggccggacagaagttcagggag
gcctggatgcagttctggtcagagacgctccccagcaagatacaacagtggcaccagaag
cagaagaacaggaaggcccaggaggacctctga

DBGET integrated database retrieval system