KEGG   Homo sapiens (human): 23491Help
Entry
23491             CDS       T01001                                 

Gene name
CES3, ES31
Definition
(RefSeq) carboxylesterase 3
  KO
K15743  carboxylesterase 3/5 [EC:3.1.1.1]
Organism
hsa  Homo sapiens (human)
Brite
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     23491 (CES3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: COesterase Abhydrolase_3 Peptidase_S9
Motif
Other DBs
NCBI-GeneID: 23491
NCBI-ProteinID: NP_079198
OMIM: 605279
HGNC: 1865
Ensembl: ENSG00000172828
Vega: OTTHUMG00000137525
Pharos: Q6UWW8(Tbio)
UniProt: Q6UWW8
Position
16q22.1
AA seq 571 aa AA seqDB search
MERAVRVESGVLVGVVCLLLACPATATGPEVAQPEVDTTLGRVRGRQVGVKGTDRLVNVF
LGIPFAQPPLGPDRFSAPHPAQPWEGVRDASTAPPMCLQDVESMNSSRFVLNGKQQIFSV
SEDCLVLNVYSPAEVPAGSGRPVMVWVHGGALITGAATSYDGSALAAYGDVVVVTVQYRL
GVLGFFSTGDEHAPGNQGFLDVVAALRWVQENIAPFGGDLNCVTVFGGSAGGSIISGLVL
SPVAAGLFHRAITQSGVITTPGIIDSHPWPLAQKIANTLACSSSSPAEMVQCLQQKEGEE
LVLSKKLKNTIYPLTVDGTVFPKSPKELLKEKPFHSVPFLMGVNNHEFSWLIPRGWGLLD
TMEQMSREDMLAISTPVLTSLDVPPEMMPTVIDEYLGSNSDAQAKCQAFQEFMGDVFINV
PTVSFSRYLRDSGSPVFFYEFQHRPSSFAKIKPAWVKADHGAEGAFVFGGPFLMDESSRL
AFPEATEEEKQLSLTMMAQWTHFARTGDPNSKALPPWPQFNQAEQYLEINPVPRAGQKFR
EAWMQFWSETLPSKIQQWHQKQKNRKAQEDL
NT seq 1716 nt NT seq  +upstreamnt  +downstreamnt
atggagagagcagtgagagtggagtccggggtcctggtcggggtggtctgtctgctcctg
gcatgccctgccacagccactgggcccgaagttgctcagcctgaagtagacaccaccctg
ggtcgtgtgcgaggccggcaggtgggcgtgaagggcacagaccgccttgtgaatgtcttt
ctgggcattccatttgcccagccgccactgggccctgaccggttctcagccccacaccca
gcacagccctgggagggtgtgcgggatgccagcactgcgcccccaatgtgcctacaagac
gtggagagcatgaacagcagcagatttgtcctcaacggaaaacagcagatcttctccgtt
tcagaggactgcctggtcctcaacgtctatagcccagctgaggtccccgcagggtccggt
aggccggtcatggtatgggtccatggaggcgctctgataactggcgctgccacctcctac
gatggatcagctctggctgcctatggggatgtggtcgtggttacagtccagtaccgcctt
ggggtccttggcttcttcagcactggagatgagcatgcacctggcaaccagggcttccta
gatgtggtagctgctttgcgctgggtgcaagaaaacatcgcccccttcgggggtgacctc
aactgtgtcactgtctttggtggatctgccggtgggagcatcatctctggcctggtcctg
tccccagtggctgcagggctgttccacagagccatcacacagagtggggtcatcaccacc
ccagggatcatcgactctcacccttggcccctagctcagaaaatcgcaaacaccttggcc
tgcagctccagctccccggctgagatggtgcagtgccttcagcagaaagaaggagaagag
ctggtccttagcaagaagctgaaaaatactatctatcctctcaccgttgatggcactgtc
ttccccaaaagccccaaggaactcctgaaggagaagcccttccactctgtgcccttcctc
atgggtgtcaacaaccatgagttcagctggctcatccccaggggctggggtctcctggat
acaatggagcagatgagccgggaggacatgctggccatctcaacacccgtcttgaccagt
ctggatgtgccccctgagatgatgcccaccgtcatagatgaatacctaggaagcaactcg
gacgcacaagccaaatgccaggcgttccaggaattcatgggtgacgtattcatcaatgtt
cccaccgtcagtttttcaagataccttcgagattctggaagccctgtctttttctatgag
ttccagcatcgacccagttcttttgcgaagatcaaacctgcctgggtgaaggctgatcat
ggggccgagggtgcttttgtgttcggaggtcccttcctcatggacgagagctcccgcctg
gcctttccagaggccacagaggaggagaagcagctaagcctcaccatgatggcccagtgg
acccactttgcccggacaggggaccccaatagcaaggctctgcctccttggccccaattc
aaccaggcggaacaatatctggagatcaacccagtgccacgggccggacagaagttcagg
gaggcctggatgcagttctggtcagagacgctccccagcaagatacaacagtggcaccag
aagcagaagaacaggaaggcccaggaggacctctga

DBGET integrated database retrieval system