KEGG   Homo sapiens (human): 23495Help
Entry
23495             CDS       T01001                                 

Gene name
TNFRSF13B, CD267, CVID, CVID2, RYZN, TACI, TNFRSF14B
Definition
tumor necrosis factor receptor superfamily, member 13B
Orthology
K05150  
tumor necrosis factor receptor superfamily member 13B
Organism
hsa  Homo sapiens (human)
Pathway
Cytokine-cytokine receptor interaction
Intestinal immune network for IgA production
Primary immunodeficiency
Disease
H00088  
Common variable immunodeficiency (CVID)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    23495 (TNFRSF13B)
 Organismal Systems
  Immune system
   04672 Intestinal immune network for IgA production
    23495 (TNFRSF13B)
 Human Diseases
  Immune diseases
   05340 Primary immunodeficiency
    23495 (TNFRSF13B)
Cellular antigens [BR:hsa04090]
 Proteins
  23495 (TNFRSF13B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
17p11.2
AA seq 293 aa AA seqDB search
MSGLGRSRRGGRSRVDQEERFPQGLWTGVAMRSCPEEQYWDPLLGTCMSCKTICNHQSQR
TCAAFCRSLSCRKEQGKFYDHLLRDCISCASICGQHPKQCAYFCENKLRSPVNLPPELRR
QRSGEVENNSDNSGRYQGLEHRGSEASPALPGLKLSADQVALVYSTLGLCLCAVLCCFLV
AVACFLKKRGDPCSCQPRSRPRQSPAKSSQDHAMEAGSPVSTSPEPVETCSFCFPECRAP
TQESAVTPGTPDPTCAGRWGCHTRTTVLQPCPHIPDSGLGIVCVPAQEGGPGA
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
atgagtggcctgggccggagcaggcgaggtggccggagccgtgtggaccaggaggagcgc
tttccacagggcctgtggacgggggtggctatgagatcctgccccgaagagcagtactgg
gatcctctgctgggtacctgcatgtcctgcaaaaccatttgcaaccatcagagccagcgc
acctgtgcagccttctgcaggtcactcagctgccgcaaggagcaaggcaagttctatgac
catctcctgagggactgcatcagctgtgcctccatctgtggacagcaccctaagcaatgt
gcatacttctgtgagaacaagctcaggagcccagtgaaccttccaccagagctcaggaga
cagcggagtggagaagttgaaaacaattcagacaactcgggaaggtaccaaggattggag
cacagaggctcagaagcaagtccagctctcccggggctgaagctgagtgcagatcaggtg
gccctggtctacagcacgctggggctctgcctgtgtgccgtcctctgctgcttcctggtg
gcggtggcctgcttcctcaagaagaggggggatccctgctcctgccagccccgctcaagg
ccccgtcaaagtccggccaagtcttcccaggatcacgcgatggaagccggcagccctgtg
agcacatcccccgagccagtggagacctgcagcttctgcttccctgagtgcagggcgccc
acgcaggagagcgcagtcacgcctgggacccccgaccccacttgtgctggaaggtggggg
tgccacaccaggaccacagtcctgcagccttgcccacacatcccagacagtggccttggc
attgtgtgtgtgcctgcccaggaggggggcccaggtgcataa

DBGET integrated database retrieval system