KEGG   Homo sapiens (human): 2350Help
Entry
2350              CDS       T01001                                 

Gene name
FOLR2, BETA-HFR, FBP, FBP/PL-1, FR-BETA, FR-P3
Definition
(RefSeq) folate receptor beta
  KO
K13649  folate receptor
Organism
hsa  Homo sapiens (human)
Pathway
hsa01523  Antifolate resistance
hsa04144  Endocytosis
Drug target
Vintafolide: D10434
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    2350 (FOLR2)
 Human Diseases
  Drug resistance
   01523 Antifolate resistance
    2350 (FOLR2)
Transporters [BR:hsa02000]
 Other Transporters
  Others
   2350 (FOLR2)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   2350 (FOLR2)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:hsa00537]
 Receptors
  2350 (FOLR2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Folate_rec
Motif
Other DBs
NCBI-GeneID: 2350
NCBI-ProteinID: NP_000794
OMIM: 136425
HGNC: 3793
Ensembl: ENSG00000165457
Vega: OTTHUMG00000150394
Pharos: P14207(Tchem)
UniProt: P14207
Structure
PDB: 

Jmol
Position
11q13.4
AA seq 255 aa AA seqDB search
MVWKWMPLLLLLVCVATMCSAQDRTDLLNVCMDAKHHKTKPGPEDKLHDQCSPWKKNACC
TASTSQELHKDTSRLYNFNWDHCGKMEPACKRHFIQDTCLYECSPNLGPWIQQVNQSWRK
ERFLDVPLCKEDCQRWWEDCHTSHTCKSNWHRGWDWTSGVNKCPAGALCRTFESYFPTPA
ALCEGLWSHSYKVSNYSRGSGRCIQMWFDSAQGNPNEEVARFYAAAMHVNAGEMLHGTGG
LLLSLALMLQLWLLG
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atggtctggaaatggatgccacttctgctgcttctggtctgtgtagccaccatgtgcagt
gcccaggacaggactgatctcctcaatgtctgtatggatgccaagcaccacaagacaaag
ccaggtcctgaggacaagctgcatgaccaatgcagtccctggaagaagaatgcctgctgc
acagccagcaccagccaggagctgcacaaggacacctcccgcctgtacaactttaactgg
gaccactgcggcaagatggagcccgcctgcaagcgccacttcatccaggacacctgtctc
tatgagtgctcacccaacctggggccctggatccagcaggtgaatcagagctggcgcaaa
gaacgcttcctggatgtgcccttatgcaaagaggactgtcagcgctggtgggaggattgt
cacacctcccacacgtgcaagagcaactggcacagaggatgggactggacctcaggagtt
aacaagtgcccagctggggctctctgccgcacctttgagtcctacttccccactccagct
gccctttgtgaaggcctctggagtcactcatacaaggtcagcaactacagccgagggagc
ggccgctgcatccagatgtggtttgattcagcccagggcaaccccaacgaggaagtggcg
aggttctatgctgcagccatgcatgtgaatgctggtgagatgcttcatgggactgggggt
ctcctgctcagtctggccctgatgctgcaactctggctccttggctga

DBGET integrated database retrieval system