KEGG   Homo sapiens (human): 23500Help
Entry
23500             CDS       T01001                                 

Gene name
DAAM2, dJ90A20A.1
Definition
(RefSeq) dishevelled associated activator of morphogenesis 2
  KO
K04512  
dishevelled associated activator of morphogenesis
Organism
hsa  Homo sapiens (human)
Pathway
Wnt signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04310 Wnt signaling pathway
    23500 (DAAM2)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of other cancer cells
   23500 (DAAM2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
Q86T65(Tbio)
UniProt: 
Position
6p21.2
AA seq 1068 aa AA seqDB search
MAPRKRSHHGLGFLCCFGGSDIPEINLRDNHPLQFMEFSSPIPNAEELNIRFAELVDELD
LTDKNREAMFALPPEKKWQIYCSKKKEQEDPNKLATSWPDYYIDRINSMAAMQSLYAFDE
EETEMRNQVVEDLKTALRTQPMRFVTRFIELEGLTCLLNFLRSMDHATCESRIHTSLIGC
IKALMNNSQGRAHVLAQPEAISTIAQSLRTENSKTKVAVLEILGAVCLVPGGHKKVLQAM
LHYQVYAAERTRFQTLLNELDRSLGRYRDEVNLKTAIMSFINAVLNAGAGEDNLEFRLHL
RYEFLMLGIQPVIDKLRQHENAILDKHLDFFEMVRNEDDLELARRFDMVHIDTKSASQMF
ELIHKKLKYTEAYPCLLSVLHHCLQMPYKRNGGYFQQWQLLDRILQQIVLQDERGVDPDL
APLENFNVKNIVNMLINENEVKQWRDQAEKFRKEHMELVSRLERKERECETKTLEKEEMM
RTLNKMKDKLARESQELRQARGQVAELVAQLSELSTGPVSSPPPPGGPLTLSSSMTTNDL
PPPPPPLPFACCPPPPPPPLPPGGPPTPPGAPPCLGMGLPLPQDPYPSSDVPLRKKRVPQ
PSHPLKSFNWVKLNEERVPGTVWNEIDDMQVFRILDLEDFEKMFSAYQRHQKELGSTEDI
YLASRKVKELSVIDGRRAQNCIILLSKLKLSNEEIRQAILKMDEQEDLAKDMLEQLLKFI
PEKSDIDLLEEHKHEIERMARADRFLYEMSRIDHYQQRLQALFFKKKFQERLAEAKPKVE
AILLASRELVRSKRLRQMLEVILAIGNFMNKGQRGGAYGFRVASLNKIADTKSSIDRNIS
LLHYLIMILEKHFPDILNMPSELQHLPEAAKVNLAELEKEVGNLRRGLRAVEVELEYQRR
QVREPSDKFVPVMSDFITVSSFSFSELEDQLNEARDKFAKALMHFGEHDSKMQPDEFFGI
FDTFLQAFSEARQDLEAMRRRKEEEERRARMEAMLKEQRERERWQRQRKVLAAGSSLEEG
GEFDDLVSALRSGEVFDKDLCKLKRSRKRSGSQALEVTRERAINRLNY
NT seq 3207 nt NT seq  +upstreamnt  +downstreamnt
atggccccccgcaagaggagccaccatggcctgggcttcctgtgctgcttcgggggcagt
gacatccccgaaatcaacctccgggacaaccaccctctgcagttcatggagttctccagc
cccatcccgaacgcagaggagctcaacatccgctttgcagagctggtggatgaattggat
ctcactgacaaaaaccgagaggctatgtttgcactgccccctgagaagaaatggcagatc
tactgcagcaagaagaaggagcaggaggaccccaacaagctggcaaccagctggcctgac
tattacatcgaccgcatcaattccatggctgcgatgcagagtctgtacgcgtttgatgag
gaggagacggagatgaggaaccaagtcgtggaagacctgaagacagccctccggacacag
cctatgaggtttgtgacccgcttcattgagctggagggcttgacctgtctgctaaatttc
ctccggagcatggaccacgccacctgtgagagccgcatccacacctcactcattggctgc
atcaaagcattgatgaacaactcccaggggcgggcacatgtgctggcacagcctgaggcc
attagtaccatagcccagagcctacgcacagagaacagcaagaccaaggtggctgtgctg
gagatcctgggtgctgtgtgcctcgtgcctggtggccacaagaaggtgctgcaggccatg
ctgcactaccaggtgtatgcagcagagcgaacccgcttccagaccctgctgaacgagcta
gaccgaagtctgggccggtaccgggatgaagtgaatctgaaaacagccatcatgtccttc
atcaatgctgtcctcaatgctggagctggagaggataatctggagttccgcctacatcta
cggtatgaattcctgatgctgggtatacagcctgtgattgacaagctccggcaacatgaa
aatgccatcctggacaaacatttagacttcttcgagatggtgcggaatgaggatgacctg
gagctagccaggaggtttgacatggtccacatcgacaccaagagtgcttcccagatgttt
gagttgatccacaagaagctgaagtacacggaggcctacccctgcctgctctctgtgctg
caccactgcctgcagatgccctacaaacggaacggtggctacttccagcagtggcagctc
ctggaccgcatcctccagcagattgtcctccaggatgagcggggtgtggaccctgacctg
gctcccttggagaacttcaatgtcaagaacatcgtcaacatgctcatcaacgagaatgaa
gtgaaacagtggcgagaccaggcagagaagttccggaaagaacacatggagcttgtgagc
cgtctggagaggaaggagcgggaatgcgagacaaagacattggagaaggaagagatgatg
cggacgctgaacaaaatgaaggacaagctggcccgggagtcccaggagctgcgccaggct
cggggacaagtggcagagctggtagcccagctcagtgaactctcaacaggccctgtatct
tccccaccaccccctgggggcccactcaccttgtcttcctcaatgacaaccaatgacctg
cctccaccccctcctcctctgccctttgcctgttgtccccctcccccaccaccacccctt
cctcccgggggacccccgactcccccaggtgccccaccttgcctcggcatgggcctgccc
ctccctcaggacccctaccccagcagtgacgtcccactcaggaaaaagcgtgtcccccag
ccttctcacccactgaagtccttcaactgggtgaagctgaatgaggagcgtgtccctggc
accgtatggaatgagattgatgacatgcaggtatttcggatcctggacctagaggatttt
gaaaagatgttttcagcctaccagaggcaccagaaagagctgggctccactgaagacatc
tacctggcttcccgcaaggtcaaagagctgtcggtcattgatggccggagggcccaaaac
tgcatcatccttctttccaagttgaagctttctaacgaggagatccggcaggccatcttg
aagatggatgagcaggaggaccttgctaaggacatgctggagcagctcctcaagttcatc
ccagagaagagtgacattgacctcctggaggagcacaagcatgaaattgagcggatggcc
cgtgctgaccgcttcctctatgaaatgagcaggattgaccactaccagcagcgactgcaa
gccctcttcttcaagaagaaattccaggagcggctggctgaggcaaagcccaaagtggaa
gccatcctgttggcctcccgggagctggtccgcagcaagcgtcttagacagatgctagag
gtcatcctagccataggcaacttcatgaacaaagggcagcgtgggggcgcctacgggttc
cgggtggccagcctcaacaagatcgctgacaccaagtccagcatcgacagaaacatctct
ctgctccattacctgatcatgatcctggagaagcattttcctgatattctaaacatgcct
tcagagctgcaacatcttccagaagctgccaaagtcaacctagcagaactggagaaggag
gtgggcaacctcaggaggggcctgagagcggtggaggtggagctggagtatcagaggcgc
caggtacgggagcccagtgacaagtttgtccctgtcatgagcgacttcatcacggtgtcc
agcttcagcttctccgagctggaggaccagctaaatgaggccagggacaagttcgccaag
gccttgatgcacttcggggagcatgacagcaagatgcagccagacgaattctttggcatc
tttgataccttcttgcaggccttctcagaggcccggcaggatctagaggccatgaggagg
aggaaggaggaggaggagcggcgggcgcgcatggaagccatgctgaaggagcagagggaa
cgtgagcggtggcagcggcagcggaaggtcctggctgcaggcagctcgctggaggaggga
ggagagttcgatgacctggtgtcggccctgcgctctggggaggtcttcgacaaggactta
tgcaagctcaagcgcagccgcaagcgatcagggagccaggccctggaagttacccgggag
cgggcaataaaccggctaaattattga

DBGET integrated database retrieval system