KEGG   Homo sapiens (human): 23513Help
Entry
23513             CDS       T01001                                 

Gene name
SCRIB, CRIB1, SCRB1, SCRIB1, Vartul
Definition
scribbled planar cell polarity protein
Orthology
K16175  
protein scribble
Organism
hsa  Homo sapiens (human)
Pathway
Hippo signaling pathway
Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04390 Hippo signaling pathway
    23513 (SCRIB)
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    23513 (SCRIB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
8q24.3
AA seq 1630 aa AA seqDB search
MLKCIPLWRCNRHVESVDKRHCSLQAVPEEIYRYSRSLEELLLDANQLRELPKPFFRLLN
LRKLGLSDNEIQRLPPEVANFMQLVELDVSRNDIPEIPESIKFCKALEIADFSGNPLSRL
PDGFTQLRSLAHLALNDVSLQALPGDVGNLANLVTLELRENLLKSLPASLSFLVKLEQLD
LGGNDLEVLPDTLGALPNLRELWLDRNQLSALPPELGNLRRLVCLDVSENRLEELPAELG
GLVLLTDLLLSQNLLRRLPDGIGQLKQLSILKVDQNRLCEVTEAIGDCENLSELILTENL
LMALPRSLGKLTKLTNLNVDRNHLEALPPEIGGCVALSVLSLRDNRLAVLPPELAHTTEL
HVLDVAGNRLQSLPFALTHLNLKALWLAENQAQPMLRFQTEDDARTGEKVLTCYLLPQQP
PPSLEDAGQQGSLSETWSDAPPSRVSVIQFLEAPIGDEDAEEAAAEKRGLQRRATPHPSE
LKVMKRSIEGRRSEACPCQPDSGSPLPAEEEKRLSAESGLSEDSRPSASTVSEAEPEGPS
AEAQGGSQQEATTAGGEEDAEEDYQEPTVHFAEDALLPGDDREIEEGQPEAPWTLPGGRQ
RLIRKDTPHYKKHFKISKLPQPEAVVALLQGMQPDGEGPVAPGGWHNGPHAPWAPRAQKE
EEEEEEGSPQEEEEEEEEENRAEEEEASTEEEDKEGAVVSAPSVKGVSFDQANNLLIEPA
RIEEEELTLTILRQTGGLGISIAGGKGSTPYKGDDEGIFISRVSEEGPAARAGVRVGDKL
LEVNGVALQGAEHHEAVEALRGAGTAVQMRVWRERMVEPENAVTITPLRPEDDYSPRERR
GGGLRLPLLPPESPGPLRQRHVACLARSERGLGFSIAGGKGSTPYRAGDAGIFVSRIAEG
GAAHRAGTLQVGDRVLSINGVDVTEARHDHAVSLLTAASPTIALLLEREAGGPLPPSPLP
HSSPPTAAVATTSITTATPGVPGLPSLAPSLLAAALEGPYPVEEIRLPRAGGPLGLSIVG
GSDHSSHPFGVQEPGVFISKVLPRGLAARSGLRVGDRILAVNGQDVRDATHQEAVSALLR
PCLELSLLVRRDPAPPGLRELCIQKAPGERLGISIRGGARGHAGNPRDPTDEGIFISKVS
PTGAAGRDGRLRVGLRLLEVNQQSLLGLTHGEAVQLLRSVGDTLTVLVCDGFEASTDAAL
EVSPGVIANPFAAGIGHRNSLESISSIDRELSPEGPGKEKELPGQTLHWGPEATEAAGRG
LQPLKLDYRALAAVPSAGSVQRVPSGAAGGKMAESPCSPSGQQPPSPPSPDELPANVKQA
YRAFAAVPTSHPPEDAPAQPPTPGPAASPEQLSFRERQKYFELEVRVPQAEGPPKRVSLV
GADDLRKMQEEEARKLQQKRAQMLREAAEAGAEARLALDGETLGEEEQEDEQPPWASPSP
TSRQSPASPPPLGGGAPVRTAKAERRHQERLRVQSPEPPAPERALSPAELRALEAEKRAL
WRAARMKSLEQDALRAQMVLSRSQEGRGTRGPLERLAEAPSPAPTPSPTPVEDLGPQTST
SPGRLSPDFAEELRSLEPSPSPGPQEEDGEVALVLLGRPSPGAVGPEDVALCSSRRPVRP
GRRGLGPVPS
NT seq 4893 nt NT seq  +upstreamnt  +downstreamnt
atgctcaagtgcatcccgctgtggcgctgcaaccggcacgtggagtcggtggacaagcgg
cactgttcgctgcaggccgtgccggaggagatctaccgctacagccgcagcctggaggag
ctgctgctcgacgccaaccagctgcgcgagctgcccaagccttttttccggctgctgaac
ttgcgcaagctgggcctgagcgacaacgagatccagcggttgcctcccgaggtggccaac
ttcatgcagctggtggagctggacgtgtcccggaacgatatccctgagatcccggagagc
atcaagttctgcaaggctctggagatcgcggacttcagcgggaaccccctctccaggctc
cctgatggcttcactcagctgcgcagcctggctcacctggccctgaatgatgtgtctctg
caggcactgcccggggacgtgggcaacctcgccaacctggtgaccctggagctccgggag
aacctgctcaagtccctgccagcgtccctgtcatttctggtcaagctggaacagctggat
ctgggaggcaacgatctggaagtgctgccagacactctgggggctctgcccaatcttcgg
gagctgtggcttgaccggaaccagctgtcagcactgcccccggagctcgggaacctgcgg
cgcctggtgtgcctggacgtgtcggaaaaccggctggaggagctgcctgctgagctcggc
gggctggtgctgctcactgacctgctgctgtcccagaacctgctgcggaggctgcccgac
ggcatcggtcagctgaagcagctatccatcctaaaggtagaccagaatcggctgtgcgag
gtgactgaggccatcggggactgtgagaacctctctgagctgatcctcacggagaacctg
ctgatggccctgccccgctccctgggaaagctgactaagctgaccaacctcaacgtggac
cggaaccacctcgaggcgctgccgcccgagatcgggggctgtgtggcactcagcgtcctc
tccttgagggacaaccgcctggccgtcctgccaccagagctggcccacacgacagagctg
cacgtgctggacgtggcggggaaccgcctgcagagtctgccgttcgcgctcacccacctc
aatctcaaggccctgtggctggcagagaaccaggcgcagcccatgctccggttccagacg
gaggatgatgcccggaccggcgagaaggtgctcacctgctacttgctgccccagcagccc
ccacccagcctcgaggatgctgggcagcaggggagcctctcggagacctggagcgatgcc
ccgccgagccgcgtcagcgtcatccagttcctggaggcccccataggtgatgaggacgct
gaggaagctgcagctgagaagcggggcctacagcgccgggccacacctcaccccagcgag
ctcaaggtgatgaagaggagcatcgaggggcggcggagcgaggcctgcccttgccagcca
gactctgggtcgcccttgcctgcagaggaggagaagcggctgagtgccgagtctggcctg
agtgaagactctcgcccatctgccagcacagtctctgaggctgagcccgagggcccgtcg
gctgaggcacagggtgggagccagcaggaagccacgactgctggcggggaggaagacgcc
gaagaggactaccaggagcccacggtgcatttcgcagaggacgcactgctgcccggggat
gacagggagatcgaggaggggcagcctgaggccccctggaccctgccaggcgggaggcag
cggctcatccgcaaggacacacctcactacaaaaagcacttcaagatctccaagctgccc
cagcccgaggccgttgtggctctgctgcagggcatgcagcctgatggggagggccctgtg
gctcccgggggctggcacaatggcccccacgcaccctgggctcctcgggcccagaaggag
gaggaggaggaggaagagggtagtcctcaggaggaggaggaagaggaggaggaggaaaac
agggctgaagaggaagaggccagcactgaggaggaggacaaggagggggccgtggtttct
gcgccctctgtcaagggagtgtcgtttgaccaggccaataacctgctgatagagcctgct
cgcattgaggaggaagagctgaccctcaccatcctgcggcagactgggggcctgggcatc
agcattgcgggcggcaagggctccacaccctataagggggacgacgagggcatattcatc
tctcgggtgtccgaggaaggccctgcggcccgggctggagtccgtgtgggtgacaagctc
ctggaggtgaatggtgtggctctgcagggcgccgagcaccacgaggccgtggaggcgctc
cggggggccggcactgccgtgcagatgcgagtgtggcgggagcgcatggtggagcctgag
aacgcggtcaccatcacgccgctgcggcccgaggatgattacagcccccgagagcggcgg
ggaggggggctgcgcctgcccctgctcccgcctgagagccccgggcccctccgtcagcgc
cacgtggcctgcctggcacgcagcgagagggggctgggcttcagcattgctggtgggaaa
ggctccacaccctacagggctggtgatgcgggcatcttcgtctcccgcattgccgagggc
ggtgctgctcaccgcgcgggcacactgcaggttggcgaccgcgtcctctctattaatgga
gtggacgtgactgaggccaggcatgaccacgccgtctccctgctgaccgctgcctccccc
accatcgccctgctgttggagcgggaggctgggggccctcttcctcccagccctctgcca
cattcctcaccccccaccgctgctgttgccaccaccagcataaccactgccacccccggg
gtgcctgggttgccgagcctggcccccagcctgctggctgccgcgttggaagggccatac
ccagtggaggagatccgtctgccaagagctgggggccctctggggcttagtattgtcgga
ggctccgaccattccagccacccgtttggtgtccaggagcctggtgtgttcatctccaag
gtgctcccgcggggcctggccgctcgcagcggcctgcgggttggggaccgcatcctggca
gtgaacgggcaagacgtgcgggatgccacgcaccaagaagcagtcagtgccctgctccgg
ccctgcctggagctgtcgctgctggtgcggagggacccggcacccccgggcctacgggaa
ctgtgcatccagaaggcacctggggagaggctgggcatcagcatccgcgggggtgccagg
ggccacgctggcaacccccgcgaccccacagacgagggcatcttcatctccaaggtgagc
cccacgggggcagccgggcgcgacggtcggctgcgtgtgggtttgcggctgttggaggtg
aaccagcagagcctgctgggcctgacgcacggcgaggcggtgcagctgctccgcagtgtg
ggcgacaccctcaccgtgctggtctgtgacggcttcgaggccagcaccgacgcagccctg
gaggtgtccccaggtgtcattgccaacccctttgcggcaggcatcggccaccggaacagc
ctggagagcatctcttccatcgaccgggagctgagccctgagggcccaggcaaggagaag
gagctgcctggacagaccctgcactgggggcccgaggccacagaagccgcaggtcggggt
ctgcagcccctgaagctggactaccgcgccctggccgccgtgcccagcgctggcagcgtg
cagagggtaccgtctggagcagctggagggaagatggctgaatctccctgctcccctagt
ggccagcagccgccctccccgccttctccggatgagctgcccgccaatgtgaagcaggcc
tacagggccttcgcggccgtgcccacttctcacccgcctgaggatgcccctgcccagccc
cccacgcctgggcctgcagcctccccggagcagctgtccttccgggagcggcagaagtac
tttgagctggaggtgcgcgtgccccaggccgagggcccccctaagcgcgtgtccctggtg
ggtgctgacgacctgcggaagatgcaggaggaggaagccagaaaactacagcagaagaga
gcgcagatgctgcgggaggcggcagaggctggggccgaagcgaggctcgccctggacggg
gagacgctgggcgaggaggaacaggaggatgagcagccaccctgggccagcccgagcccc
acctcaaggcagagcccggcgtcccccccgcccctgggaggtggcgccccggtgcggacg
gccaaagctgaacggcgccaccaggagcggctgcgcgtgcagagtccggagccaccggca
cccgagcgtgccctgtcccctgccgagctccgggccctggaggccgagaagcgtgcgctg
tggagggcagccaggatgaagtcattggaacaggacgctctccgagcacagatggtcctc
agcaggtcccaggaaggccggggcacgcgggggcccctggagcgactggccgaggcccct
tcccctgcgcccaccccgtcgcccacccctgtggaagacctcggcccccagaccagcacc
tccccgggacgcctgtcaccggactttgctgaggagttgaggtccctggaaccatctccc
agccctggcccgcaggaggaggatggagaagtggctctggtgcttctgggcaggccctca
cccggcgctgtgggccctgaagatgtggcactgtgcagcagccgccgccccgtaaggcct
gggcgccgtggcctgggccctgtgccctcctag

DBGET integrated database retrieval system