KEGG   Homo sapiens (human): 2352Help
Entry
2352              CDS       T01001                                 

Gene name
FOLR3, FR-G, FR-gamma, gamma-hFR
Definition
folate receptor 3 (gamma)
Orthology
K13649  
folate receptor
Organism
hsa  Homo sapiens (human)
Pathway
Endocytosis
Drug target
Vintafolide: 
Class
Cellular Processes; Transport and catabolism; Endocytosis [PATH:hsa04144]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
11q13
AA seq 245 aa AA seqDB search
MDMAWQMMQLLLLALVTAAGSAQPRSARARTDLLNVCMNAKHHKTQPSPEDELYGQCSPW
KKNACCTASTSQELHKDTSRLYNFNWDHCGKMEPTCKRHFIQDSCLYECSPNLGPWIRQV
NQSWRKERILNVPLCKEDCERWWEDCRTSYTCKSNWHKGWNWTSGINECPAGALCSTFES
YFPTPAALCEGLWSHSFKVSNYSRGSGRCIQMWFDSAQGNPNEEVAKFYAAAMNAGAPSR
GIIDS
NT seq 738 nt NT seq  +upstreamnt  +downstreamnt
atggacatggcctggcagatgatgcagctgctgcttctggctttggtgactgctgcgggg
agtgcccagcccaggagtgcgcgggccaggacggacctgctcaatgtctgcatgaacgcc
aagcaccacaagacacagcccagccccgaggacgagctgtatggccagtgcagtccctgg
aagaagaatgcctgctgcacggccagcaccagccaggagctgcacaaggacacctcccgc
ctgtacaactttaactgggatcactgtggtaagatggaacccacctgcaagcgccacttt
atccaggacagctgtctctatgagtgctcacccaacctggggccctggatccggcaggtc
aaccagagctggcgcaaagagcgcattctgaacgtgcccctgtgcaaagaggactgtgag
cgctggtgggaggactgtcgcacctcctacacctgcaaaagcaactggcacaaaggctgg
aattggacctcagggattaatgagtgtccggccggggccctctgcagcacctttgagtcc
tacttccccactccagccgccctttgtgaaggcctctggagccactccttcaaggtcagc
aactatagtcgagggagcggccgctgcatccagatgtggtttgactcagcccagggcaac
cccaatgaggaggtggccaagttctatgctgcggccatgaatgctggggccccgtctcgt
gggattattgattcctga

DBGET integrated database retrieval system