KEGG   Homo sapiens (human): 23522Help
Entry
23522             CDS       T01001                                 

Gene name
KAT6B, GTPTS, MORF, MOZ2, MYST4, ZC2HC6B, qkf, querkopf
Definition
(RefSeq) lysine acetyltransferase 6B (EC:2.3.1.48)
  KO
K11306  
histone acetyltransferase MYST4 [EC:2.3.1.48]
Organism
hsa  Homo sapiens (human)
Brite
Enzymes [BR:hsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     23522 (KAT6B)
Chromosome [BR:hsa03036]
 Eukaryotic Type
  Histone modification proteins
   HATs (histone acetyltransferases)
    23522 (KAT6B)
   HAT complexes
    MOZ/MORF complex
     23522 (KAT6B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
10q22.2
AA seq 2073 aa AA seqDB search
MVKLANPLYTEWILEAIQKIKKQKQRPSEERICHAVSTSHGLDKKTVSEQLELSVQDGSV
LKVTNKGLASYKDPDNPGRFSSVKPGTFPKSAKGSRGSCNDLRNVDWNKLLRRAIEGLEE
PNGSSLKNIEKYLRSQSDLTSTTNNPAFQQRLRLGAKRAVNNGRLLKDGPQYRVNYGSLD
GKGAPQYPSAFPSSLPPVSLLPHEKDQPRADPIPICSFCLGTKESNREKKPEELLSCADC
GSSGHPSCLKFCPELTTNVKALRWQCIECKTCSACRVQGRNADNMLFCDSCDRGFHMECC
DPPLSRMPKGMWICQVCRPKKKGRKLLHEKAAQIKRRYAKPIGRPKNKLKQRLLSVTSDE
GSMNAFTGRGSPGRGQKTKVCTTPSSGHAASGKDSSSRLAVTDPTRPGATTKITTTSTYI
SASTLKVNKKTKGLIDGLTKFFTPSPDGRRSRGEIIDFSKHYRPRKKVSQKQSCTSHVLA
TGTTQKLKPPPSSLPPPTPISGQSPSSQKSSTATSSPSPQSSSSQCSVPSLSSLTTNSQL
KALFDGLSHIYTTQGQSRKKGHPSYAPPKRMRRKTELSSTAKSKAHFFGKRDIRSRFISH
SSSSSWGMARGSIFKAIAHFKRTTFLKKHRMLGRLKYKVTPQMGTPSPGKGSLTDGRIKP
DQDDDTEIKINIKQESADVNVIGNKDVVTEEDLDVFKQAQELSWEKIECESGVEDCGRYP
SVIEFGKYEIQTWYSSPYPQEYARLPKLYLCEFCLKYMKSKNILLRHSKKCGWFHPPANE
IYRRKDLSVFEVDGNMSKIYCQNLCLLAKLFLDHKTLYYDVEPFLFYVLTKNDEKGCHLV
GYFSKEKLCQQKYNVSCIMIMPQHQRQGFGRFLIDFSYLLSRREGQAGSPEKPLSDLGRL
SYLAYWKSVILEYLYHHHERHISIKAISRATGMCPHDIATTLQHLHMIDKRDGRFVIIRR
EKLILSHMEKLKTCSRANELDPDSLRWTPILISNAAVSEEEREAEKEAERLMEQASCWEK
EEQEILSTRANSRQSPAKVQSKNKYLHSPESRPVTGERGQLLELSKESSEEEEEEEDEEE
EEEEEEEEEDEEEEEEEEEEEEEENIQSSPPRLTKPQSVAIKRKRPFVLKKKRGRKRRRI
NSSVTTETISETTEVLNEPFDNSDEERPMPQLEPTCEIEVEEDGRKPVLRKAFQHQPGKK
RQTEEEEGKDNHCFKNADPCRNNMNDDSSNLKEGSKDNPEPLKCKQVWPKGTKRGLSKWR
QNKERKTGFKLNLYTPPETPMEPDEQVTVEEQKETSEGKTSPSPIRIEEEVKETGEALLP
QEENRREETCAPVSPNTSPGEKPEDDLIKPEEEEEEEEEEEEEEEEEEGEEEEGGGNVEK
DPDGAKSQEKEEPEISTEKEDSARLDDHEEEEEEDEEPSHNEDHDADDEDDSHMESAEVE
KEELPRESFKEVLENQETFLDLNVQPGHSNPEVLMDCGVDLTASCNSEPKELAGDPEAVP
ESDEEPPPGEQAQKQDQKNSKEVDTEFKEGNPATMEIDSETVQAVQSLTQESSEQDDTFQ
DCAETQEACRSLQNYTRADQSPQIATTLDDCQQSDHSSPVSSVHSHPGQSVRSVNSPSVP
ALENSYAQISPDQSAISVPSLQNMETSPMMDVPSVSDHSQQVVDSGFSDLGSIESTTENY
ENPSSYDSTMGGSICGNGSSQNSCSYSNLTSSSLTQSSCAVTQQMSNISGSCSMLQQTSI
SSPPTCSVKSPQGCVVERPPSSSQQLAQCSMAANFTPPMQLAEIPETSNANIGLYERMGQ
SDFGAGHYPQPSATFSLAKLQQLTNTLIDHSLPYSHSAAVTSYANSASLSTPLSNTGLVQ
LSQSPHSVPGGPQAQATMTPPPNLTPPPMNLPPPLLQRNMAASNIGISHSQRLQTQIASK
GHISMRTKSASLSPAAATHQSQIYGRSQTVAMQGPARTLTMQRGMNMSVNLMPAPAYNVN
SVNMNMNTLNAMNGYSMSQPMMNSGYHSNHGYMNQTPQYPMQMQMGMMGTQPYAQQPMQT
PPHGNMMYTAPGHHGYMNTGMSKQSLNGSYMRR
NT seq 6222 nt NT seq  +upstreamnt  +downstreamnt
atggtaaaacttgcaaacccactttatacagagtggattcttgaagctatacagaaaata
aaaaagcaaaagcaaaggccctctgaagagagaatctgccatgcggtcagtacttcccat
gggttggataagaagacagtctctgaacagctggaactcagtgttcaggatggctcagtt
ctcaaagtcaccaacaaaggccttgcctcctataaggacccagacaaccctgggcgcttt
tcatcagttaaaccaggcacttttcctaagtcagccaaggggtctagaggatcatgtaat
gatctccgcaatgtggattggaataaacttttaaggagagcaattgaaggacttgaggag
ccgaatggctcctccctgaagaacatagagaagtatctcagaagtcaaagtgatctcaca
agcaccaccaacaacccagcctttcagcagcggctgcgactgggggccaaacgcgctgtg
aataatgggaggttactgaaagacggaccgcagtacagggtcaattatgggagcttagat
ggcaaaggggcacctcagtatcccagtgcattcccatcctcgctcccacctgtcagcctt
ctaccccatgagaaagaccagccccgtgctgatcccattccaatatgtagcttctgtttg
gggactaaagaatcaaatcgtgaaaagaaaccagaagaactcctctcttgtgcagattgt
ggcagtagtggacacccatcctgtttgaaattttgtcctgaattaacaacaaatgtaaag
gccttaaggtggcagtgcatcgaatgcaagacatgcagtgcctgtagagtccaaggcaga
aatgctgataatatgcttttttgtgattcctgtgatagaggatttcatatggaatgctgt
gacccaccactttccagaatgccaaaagggatgtggatttgccaagtctgcagaccaaag
aaaaagggaagaaaactacttcatgagaaagctgcacaaataaaacgacgatatgcaaaa
cccattggacgaccgaaaaataaattaaagcaacgattgttgtctgtaaccagtgatgaa
ggatccatgaatgcattcacaggaagggggtcacctggtaggggtcaaaagactaaagtc
tgtaccacaccttcatctggtcatgctgcatctgggaaggactcaagcagcagattggct
gttacagaccccactcggcctggtgccaccaccaaaatcaccaccacctccacctacatt
tctgcctctacacttaaagttaacaagaaaaccaaagggctcattgatggccttactaag
ttttttacaccatcacctgatggtcgcagatcacgaggtgaaattatagacttttcaaag
cactatcgtccaaggaaaaaggtctctcagaaacagtcatgcacttctcatgtgttggct
acaggtaccacacaaaagctaaaacctccaccttcttcacttccacccccaacccccatc
tccggtcagagccccagttcacaaaagtccagcacggccacttcttctccctctccccag
agttcttccagccagtgcagtgtgccctccctgagcagccttaccactaacagccagctg
aaggcactctttgatgggctttctcatatctataccactcagggacagtctcgcaaaaag
ggacacccgagttatgcaccacccaaacgtatgcgtcgtaaaactgaattatcttccacg
gcaaaatctaaagcccacttctttggcaaaagagatattagaagtcggtttatttctcac
tcctcctcctctagctgggggatggctagaggaagtatttttaaagcaattgctcacttc
aagcgaacaactttccttaaaaagcacaggatgctaggcagattaaaatataaagtgacc
cctcagatggggaccccctcaccagggaaggggagcttgacagacggaaggattaaacct
gatcaggatgatgatactgaaataaaaataaacatcaaacaagaaagtgcagatgtaaat
gtgattggaaacaaggatgtcgttactgaagaggatttggatgtttttaagcaggcccag
gaactttcttgggagaaaatagagtgtgagagtggggtggaagactgtggccggtaccct
tctgtgattgaatttggtaaatatgaaatccaaacctggtactcctcgccttacccacag
gaatatgcaagattaccaaagctttacctgtgtgaattctgtcttaaatatatgaaaagt
aaaaatattttgctaagacactccaagaagtgtggatggtttcatcctccagcaaatgaa
atttaccgaaggaaagacctttcagtatttgaggttgatgggaatatgagcaaaatttat
tgccaaaacctttgcttgttagccaagctcttcctggaccacaaaacgttgtattatgat
gtcgagccattccttttttatgtccttacaaaaaatgatgaaaagggctgtcatctggtt
ggatacttctctaaggaaaagctttgccagcagaagtataatgtctcctgcataatgatc
atgccccagcaccaaaggcaaggatttggacggtttctcattgatttcagctatttgctt
tctagaagagaaggccaagcagggtctcctgaaaagcctctctccgatctgggccgtctc
tcctacctggcatattggaagagcgtcatcttggagtatctctaccaccaccatgagagg
cacatcagcatcaaggcaattagcagagcgacgggcatgtgcccacatgacattgccacc
actctgcagcacctccacatgatcgacaagagagatggcagatttgtcatcattagacgg
gaaaagttgatattgagccacatggaaaagctgaaaacctgttccagagccaatgaactt
gatccagacagtctgaggtggaccccaattttaatttctaatgctgcagtgtctgaagaa
gagcgagaagctgagaaagaggctgagcggctaatggaacaagctagctgctgggagaag
gaggaacaagaaatcctgtcaactagagctaacagtaggcaatcacctgcaaaagtacaa
tcgaaaaataaatatttgcattccccggagagccggccagtcacaggggagcgagggcag
ctgctggagctgtctaaagagagcagtgaagaagaagaggaggaggaggacgaggaggag
gaagaagaggaggaagaagaggaagaggatgaagaggaggaagaagaggaagaagaagaa
gaagaagaagaaaatattcaaagctctcccccaagattgacgaaaccacagtcagttgcc
ataaagagaaagaggccttttgtactaaagaagaaaaggggtcgtaaacgcaggaggatc
aacagcagtgtaacaacagagaccatttcagagacgacagaagtactgaatgagcccttt
gacaactcagatgaagagaggccaatgccacagctggagcctacctgtgagattgaagtg
gaggaagatggcaggaagccagtcctgagaaaagcattccagcatcagcctgggaagaaa
agacaaacagaggaagaggaaggaaaagacaatcattgcttcaagaatgctgacccttgt
agaaacaatatgaatgatgattcaagtaacttgaaagaaggcagtaaagacaatcccgaa
cctctaaagtgcaaacaagtgtggccaaaaggaacaaagcgcggtctatctaagtggagg
caaaacaaagagaggaagaccggatttaaactgaatttgtacaccccgccagaaacaccc
atggagcctgacgagcaggtaacagtggaagaacagaaggagacttcagaaggaaaaacc
agccccagtcccatcaggattgaggaggaggtcaaggaaactggggaagccctgttgcct
caagaggaaaacagaagggaagaaacatgtgcccctgtaagtccaaacacatcaccaggt
gaaaaaccagaagatgatctcatcaaacctgaggaagaggaagaggaggaggaggaggaa
gaggaagaagaggaagaagaggaaggggaagaagaagaaggaggaggaaatgtagaaaaa
gatccagatggtgctaaaagccaagaaaaagaggaaccagaaatctccacggaaaaagaa
gactctgcacgtttggatgatcacgaagaggaggaggaagaggatgaagagccatcccac
aacgaggaccatgatgccgatgacgaggatgacagccacatggagtctgccgaagtggag
aaggaagagctgcccagagaaagcttcaaagaagtactggaaaaccaggagactttttta
gaccttaatgtgcagcctggtcactcgaacccagaggtcttaatggactgtggcgtcgac
ctgacagcttcttgtaacagtgagcccaaggagcttgctggggaccctgaagctgtaccc
gaatctgacgaggagccacccccaggagaacaggcacagaagcaggaccaaaagaacagc
aaggaagtcgatacagagttcaaagagggaaacccagcaaccatggaaatcgactctgag
actgtccaggccgttcagtctttgacccaggagagcagcgaacaggacgacacctttcag
gattgtgccgagactcaagaggcctgtagaagcctacagaactacacccgtgcagaccaa
agtccacagattgccaccacgctcgacgattgccaacagtcggaccacagtagcccagtt
tcatccgtccactcccatcctggccagtccgtacgttctgtcaacagcccaagtgtccct
gctctggaaaacagctacgcccaaatcagcccagatcaaagtgccatctcagtgccatct
ctgcagaacatggaaaccagtcccatgatggatgtcccatcagtttcagatcattcacag
caagtcgtagacagtggatttagtgacctgggcagtatcgagagcacaactgagaactac
gaaaacccaagcagctacgattctactatgggaggcagcatctgtggaaacggctcttca
cagaacagctgctcctatagcaacctcacctccagcagtctgacacagagcagctgtgct
gtcacccagcagatgtccaacatcagcgggagctgcagcatgctgcagcaaaccagcatc
agctcccctccgacctgcagcgtcaagtctcctcaaggctgtgtggtggagaggcctccg
agcagcagccagcagctggctcagtgcagcatggctgctaacttcaccccacccatgcag
ctggctgaaatccccgagacgagcaacgccaacattggcttatacgagcgaatgggtcag
agtgattttggggctgggcattacccgcagccgtcagccaccttcagccttgccaaactg
cagcagttaactaatacacttattgatcattcattgccttacagccattccgctgctgtg
acttcctatgcaaacagtgcctctttgtccacaccattaagtaacacagggcttgttcaa
ctttctcagtctccacactccgtccctgggggaccccaagcacaagctaccatgacccca
ccccccaacctgactcctcctccaatgaatctgccgccgcctcttttgcaacggaacatg
gctgcatcaaatattggcatctctcacagccaaagactgcaaacccagattgccagcaag
ggccacatctccatgagaaccaagtcagcgtctctgtcaccagccgctgccacccatcag
tcacaaatctatgggcgctcccagactgtagccatgcagggtcctgcacggactttaacg
atgcaaagaggcatgaacatgagtgtgaacctgatgccagcgccagcctacaatgtcaac
tctgtgaacatgaacatgaacactctcaacgccatgaatgggtacagcatgtcccagcca
atgatgaacagtggctaccacagcaatcatggctatatgaatcaaacgccccaataccct
atgcagatgcagatgggcatgatgggcacccagccatatgcccagcagccaatgcagacc
ccaccccacggtaacatgatgtacacggcccccggacatcacggctacatgaacacaggc
atgtccaaacagtctctcaatggctcctacatgagaaggtag

DBGET integrated database retrieval system