KEGG   Homo sapiens (human): 23522Help
Entry
23522             CDS       T01001                                 

Gene name
KAT6B, GTPTS, MORF, MOZ2, MYST4, ZC2HC6B, qkf, querkopf
Definition
K(lysine) acetyltransferase 6B (EC:2.3.1.48)
Orthology
K11306  
histone acetyltransferase MYST4 [EC:2.3.1.48]
Organism
hsa  Homo sapiens (human)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
10q22.2
AA seq 1890 aa AA seqDB search
MVKLANPLYTEWILEAIQKIKKQKQRPSEERICHAVSTSHGLDKKTVSEQLELSVQDGSV
LKVTNKGLASYKDPDNPGRFSSVKPGTFPKSAKGSRGSCNDLRNVDWNKLLRRAIEGLEE
PNGSSLKNIEKYLRSQSDLTSTTNNPAFQQRLRLGAKRAVNNGRLLKDGPQYRVNYGSLD
GKGAPQYPSAFPSSLPPVSLLPHEKDQPRADPIPICSFCLGTKESNREKKPEELLSCADC
GSSGHPSCLKFCPELTTNVKALRWQCIECKTCSACRVQGRNADNMLFCDSCDRGFHMECC
DPPLSRMPKGMWICQVCRPKKKGRKLLHEKAAQIKRRYAKPIGRPKNKLKQRLLSVTSDE
GSMNAFTGRGSPGRGQKTKVCTTPSSGHAASGKDSSSRLAVTDPTRPGATTKITTTSTYI
SASTLKVNKKTKGLIDGLTKFFTPSPDGRRSRGEIIDFSKHYRPRKKVSQKQSCTSHVLA
TDTEIKINIKQESADVNVIGNKDVVTEEDLDVFKQAQELSWEKIECESGVEDCGRYPSVI
EFGKYEIQTWYSSPYPQEYARLPKLYLCEFCLKYMKSKNILLRHSKKCGWFHPPANEIYR
RKDLSVFEVDGNMSKIYCQNLCLLAKLFLDHKTLYYDVEPFLFYVLTKNDEKGCHLVGYF
SKEKLCQQKYNVSCIMIMPQHQRQGFGRFLIDFSYLLSRREGQAGSPEKPLSDLGRLSYL
AYWKSVILEYLYHHHERHISIKAISRATGMCPHDIATTLQHLHMIDKRDGRFVIIRREKL
ILSHMEKLKTCSRANELDPDSLRWTPILISNAAVSEEEREAEKEAERLMEQASCWEKEEQ
EILSTRANSRQSPAKVQSKNKYLHSPESRPVTGERGQLLELSKESSEEEEEEEDEEEEEE
EEEEEEDEEEEEEEEEEEEEENIQSSPPRLTKPQSVAIKRKRPFVLKKKRGRKRRRINSS
VTTETISETTEVLNEPFDNSDEERPMPQLEPTCEIEVEEDGRKPVLRKAFQHQPGKKRQT
EEEEGKDNHCFKNADPCRNNMNDDSSNLKEGSKDNPEPLKCKQVWPKGTKRGLSKWRQNK
ERKTGFKLNLYTPPETPMEPDEQVTVEEQKETSEGKTSPSPIRIEEEVKETGEALLPQEE
NRREETCAPVSPNTSPGEKPEDDLIKPEEEEEEEEEEEEEEEEEEGEEEEGGGNVEKDPD
GAKSQEKEEPEISTEKEDSARLDDHEEEEEEDEEPSHNEDHDADDEDDSHMESAEVEKEE
LPRESFKEVLENQETFLDLNVQPGHSNPEVLMDCGVDLTASCNSEPKELAGDPEAVPESD
EEPPPGEQAQKQDQKNSKEVDTEFKEGNPATMEIDSETVQAVQSLTQESSEQDDTFQDCA
ETQEACRSLQNYTRADQSPQIATTLDDCQQSDHSSPVSSVHSHPGQSVRSVNSPSVPALE
NSYAQISPDQSAISVPSLQNMETSPMMDVPSVSDHSQQVVDSGFSDLGSIESTTENYENP
SSYDSTMGGSICGNGSSQNSCSYSNLTSSSLTQSSCAVTQQMSNISGSCSMLQQTSISSP
PTCSVKSPQGCVVERPPSSSQQLAQCSMAANFTPPMQLAEIPETSNANIGLYERMGQSDF
GAGHYPQPSATFSLAKLQQLTNTLIDHSLPYSHSAAVTSYANSASLSTPLSNTGLVQLSQ
SPHSVPGGPQAQATMTPPPNLTPPPMNLPPPLLQRNMAASNIGISHSQRLQTQIASKGHI
SMRTKSASLSPAAATHQSQIYGRSQTVAMQGPARTLTMQRGMNMSVNLMPAPAYNVNSVN
MNMNTLNAMNGYSMSQPMMNSGYHSNHGYMNQTPQYPMQMQMGMMGTQPYAQQPMQTPPH
GNMMYTAPGHHGYMNTGMSKQSLNGSYMRR
NT seq 5673 nt NT seq  +upstreamnt  +downstreamnt
atggtaaaacttgcaaacccactttatacagagtggattcttgaagctatacagaaaata
aaaaagcaaaagcaaaggccctctgaagagagaatctgccatgcggtcagtacttcccat
gggttggataagaagacagtctctgaacagctggaactcagtgttcaggatggctcagtt
ctcaaagtcaccaacaaaggccttgcctcctataaggacccagacaaccctgggcgcttt
tcatcagttaaaccaggcacttttcctaagtcagccaaggggtctagaggatcatgtaat
gatctccgcaatgtggattggaataaacttttaaggagagcaattgaaggacttgaggag
ccgaatggctcctccctgaagaacatagagaagtatctcagaagtcaaagtgatctcaca
agcaccaccaacaacccagcctttcagcagcggctgcgactgggggccaaacgcgctgtg
aataatgggaggttactgaaagacggaccgcagtacagggtcaattatgggagcttagat
ggcaaaggggcacctcagtatcccagtgcattcccatcctcgctcccacctgtcagcctt
ctaccccatgagaaagaccagccccgtgctgatcccattccaatatgtagcttctgtttg
gggactaaagaatcaaatcgtgaaaagaaaccagaagaactcctctcttgtgcagattgt
ggcagtagtggacacccatcctgtttgaaattttgtcctgaattaacaacaaatgtaaag
gccttaaggtggcagtgcatcgaatgcaagacatgcagtgcctgtagagtccaaggcaga
aatgctgataatatgcttttttgtgattcctgtgatagaggatttcatatggaatgctgt
gacccaccactttccagaatgccaaaagggatgtggatttgccaagtctgcagaccaaag
aaaaagggaagaaaactacttcatgagaaagctgcacaaataaaacgacgatatgcaaaa
cccattggacgaccgaaaaataaattaaagcaacgattgttgtctgtaaccagtgatgaa
ggatccatgaatgcattcacaggaagggggtcacctggtaggggtcaaaagactaaagtc
tgtaccacaccttcatctggtcatgctgcatctgggaaggactcaagcagcagattggct
gttacagaccccactcggcctggtgccaccaccaaaatcaccaccacctccacctacatt
tctgcctctacacttaaagttaacaagaaaaccaaagggctcattgatggccttactaag
ttttttacaccatcacctgatggtcgcagatcacgaggtgaaattatagacttttcaaag
cactatcgtccaaggaaaaaggtctctcagaaacagtcatgcacttctcatgtgttggct
acagatactgaaataaaaataaacatcaaacaagaaagtgcagatgtaaatgtgattgga
aacaaggatgtcgttactgaagaggatttggatgtttttaagcaggcccaggaactttct
tgggagaaaatagagtgtgagagtggggtggaagactgtggccggtacccttctgtgatt
gaatttggtaaatatgaaatccaaacctggtactcctcgccttacccacaggaatatgca
agattaccaaagctttacctgtgtgaattctgtcttaaatatatgaaaagtaaaaatatt
ttgctaagacactccaagaagtgtggatggtttcatcctccagcaaatgaaatttaccga
aggaaagacctttcagtatttgaggttgatgggaatatgagcaaaatttattgccaaaac
ctttgcttgttagccaagctcttcctggaccacaaaacgttgtattatgatgtcgagcca
ttccttttttatgtccttacaaaaaatgatgaaaagggctgtcatctggttggatacttc
tctaaggaaaagctttgccagcagaagtataatgtctcctgcataatgatcatgccccag
caccaaaggcaaggatttggacggtttctcattgatttcagctatttgctttctagaaga
gaaggccaagcagggtctcctgaaaagcctctctccgatctgggccgtctctcctacctg
gcatattggaagagcgtcatcttggagtatctctaccaccaccatgagaggcacatcagc
atcaaggcaattagcagagcgacgggcatgtgcccacatgacattgccaccactctgcag
cacctccacatgatcgacaagagagatggcagatttgtcatcattagacgggaaaagttg
atattgagccacatggaaaagctgaaaacctgttccagagccaatgaacttgatccagac
agtctgaggtggaccccaattttaatttctaatgctgcagtgtctgaagaagagcgagaa
gctgagaaagaggctgagcggctaatggaacaagctagctgctgggagaaggaggaacaa
gaaatcctgtcaactagagctaacagtaggcaatcacctgcaaaagtacaatcgaaaaat
aaatatttgcattccccggagagccggccagtcacaggggagcgagggcagctgctggag
ctgtctaaagagagcagtgaagaagaagaggaggaggaggacgaggaggaggaagaagag
gaggaagaagaggaagaggatgaagaggaggaagaagaggaagaagaagaagaagaagaa
gaaaatattcaaagctctcccccaagattgacgaaaccacagtcagttgccataaagaga
aagaggccttttgtactaaagaagaaaaggggtcgtaaacgcaggaggatcaacagcagt
gtaacaacagagaccatttcagagacgacagaagtactgaatgagccctttgacaactca
gatgaagagaggccaatgccacagctggagcctacctgtgagattgaagtggaggaagat
ggcaggaagccagtcctgagaaaagcattccagcatcagcctgggaagaaaagacaaaca
gaggaagaggaaggaaaagacaatcattgcttcaagaatgctgacccttgtagaaacaat
atgaatgatgattcaagtaacttgaaagaaggcagtaaagacaatcccgaacctctaaag
tgcaaacaagtgtggccaaaaggaacaaagcgcggtctatctaagtggaggcaaaacaaa
gagaggaagaccggatttaaactgaatttgtacaccccgccagaaacacccatggagcct
gacgagcaggtaacagtggaagaacagaaggagacttcagaaggaaaaaccagccccagt
cccatcaggattgaggaggaggtcaaggaaactggggaagccctgttgcctcaagaggaa
aacagaagggaagaaacatgtgcccctgtaagtccaaacacatcaccaggtgaaaaacca
gaagatgatctcatcaaacctgaggaagaggaagaggaggaggaggaggaagaggaagaa
gaggaagaagaggaaggggaagaagaagaaggaggaggaaatgtagaaaaagatccagat
ggtgctaaaagccaagaaaaagaggaaccagaaatctccacggaaaaagaagactctgca
cgtttggatgatcacgaagaggaggaggaagaggatgaagagccatcccacaacgaggac
catgatgccgatgacgaggatgacagccacatggagtctgccgaagtggagaaggaagag
ctgcccagagaaagcttcaaagaagtactggaaaaccaggagacttttttagaccttaat
gtgcagcctggtcactcgaacccagaggtcttaatggactgtggcgtcgacctgacagct
tcttgtaacagtgagcccaaggagcttgctggggaccctgaagctgtacccgaatctgac
gaggagccacccccaggagaacaggcacagaagcaggaccaaaagaacagcaaggaagtc
gatacagagttcaaagagggaaacccagcaaccatggaaatcgactctgagactgtccag
gccgttcagtctttgacccaggagagcagcgaacaggacgacacctttcaggattgtgcc
gagactcaagaggcctgtagaagcctacagaactacacccgtgcagaccaaagtccacag
attgccaccacgctcgacgattgccaacagtcggaccacagtagcccagtttcatccgtc
cactcccatcctggccagtccgtacgttctgtcaacagcccaagtgtccctgctctggaa
aacagctacgcccaaatcagcccagatcaaagtgccatctcagtgccatctctgcagaac
atggaaaccagtcccatgatggatgtcccatcagtttcagatcattcacagcaagtcgta
gacagtggatttagtgacctgggcagtatcgagagcacaactgagaactacgaaaaccca
agcagctacgattctactatgggaggcagcatctgtggaaacggctcttcacagaacagc
tgctcctatagcaacctcacctccagcagtctgacacagagcagctgtgctgtcacccag
cagatgtccaacatcagcgggagctgcagcatgctgcagcaaaccagcatcagctcccct
ccgacctgcagcgtcaagtctcctcaaggctgtgtggtggagaggcctccgagcagcagc
cagcagctggctcagtgcagcatggctgctaacttcaccccacccatgcagctggctgaa
atccccgagacgagcaacgccaacattggcttatacgagcgaatgggtcagagtgatttt
ggggctgggcattacccgcagccgtcagccaccttcagccttgccaaactgcagcagtta
actaatacacttattgatcattcattgccttacagccattccgctgctgtgacttcctat
gcaaacagtgcctctttgtccacaccattaagtaacacagggcttgttcaactttctcag
tctccacactccgtccctgggggaccccaagcacaagctaccatgaccccaccccccaac
ctgactcctcctccaatgaatctgccgccgcctcttttgcaacggaacatggctgcatca
aatattggcatctctcacagccaaagactgcaaacccagattgccagcaagggccacatc
tccatgagaaccaagtcagcgtctctgtcaccagccgctgccacccatcagtcacaaatc
tatgggcgctcccagactgtagccatgcagggtcctgcacggactttaacgatgcaaaga
ggcatgaacatgagtgtgaacctgatgccagcgccagcctacaatgtcaactctgtgaac
atgaacatgaacactctcaacgccatgaatgggtacagcatgtcccagccaatgatgaac
agtggctaccacagcaatcatggctatatgaatcaaacgccccaataccctatgcagatg
cagatgggcatgatgggcacccagccatatgcccagcagccaatgcagaccccaccccac
ggtaacatgatgtacacggcccccggacatcacggctacatgaacacaggcatgtccaaa
cagtctctcaatggctcctacatgagaaggtag

DBGET integrated database retrieval system