KEGG   Homo sapiens (human): 23527Help
Entry
23527             CDS       T01001                                 

Gene name
ACAP2, CENTB2, CNT-B2
Definition
ArfGAP with coiled-coil, ankyrin repeat and PH domains 2
Orthology
K12489  
Arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein
Organism
hsa  Homo sapiens (human)
Pathway
Endocytosis
Class
Cellular Processes; Transport and catabolism; Endocytosis [PATH:hsa04144]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
3q29
AA seq 778 aa AA seqDB search
MKMTVDFEECLKDSPRFRAALEEVEGDVAELELKLDKLVKLCIAMIDTGKAFCVANKQFM
NGIRDLAQYSSNDAVVETSLTKFSDSLQEMINFHTILFDQTQRSIKAQLQNFVKEDLRKF
KDAKKQFEKVSEEKENALVKNAQVQRNKQHEVEEATNILTATRKCFRHIALDYVLQINVL
QSKRRSEILKSMLSFMYAHLAFFHQGYDLFSELGPYMKDLGAQLDRLVVDAAKEKREMEQ
KHSTIQQKDFSSDDSKLEYNVDAANGIVMEGYLFKRASNAFKTWNRRWFSIQNNQLVYQK
KFKDNPTVVVEDLRLCTVKHCEDIERRFCFEVVSPTKSCMLQADSEKLRQAWIKAVQTSI
ATAYREKGDESEKLDKKSSPSTGSLDSGNESKEKLLKGESALQRVQCIPGNASCCDCGLA
DPRWASINLGITLCIECSGIHRSLGVHFSKVRSLTLDTWEPELLKLMCELGNDVINRVYE
ANVEKMGIKKPQPGQRQEKEAYIRAKYVERKFVDKYSISLSPPEQQKKFVSKSSEEKRLS
ISKFGPGDQVRASAQSSVRSNDSGIQQSSDDGRESLPSTVSANSLYEPEGERQDSSMFLD
SKHLNPGLQLYRASYEKNLPKMAEALAHGADVNWANSEENKATPLIQAVLGGSLVTCEFL
LQNGANVNQRDVQGRGPLHHATVLGHTGQVCLFLKRGANQHATDEEGKDPLSIAVEAANA
DIVTLLRLARMNEEMRESEGLYGQPGDETYQDIFRDFSQMASNNPEKLNRFQQDSQKF
NT seq 2337 nt NT seq  +upstreamnt  +downstreamnt
atgaagatgactgtggatttcgaggagtgtctgaaggactcgccccgcttcagggcagct
ttggaagaagtagaaggtgatgtggcagaattggaactaaaacttgataagcttgtgaaa
ctttgtattgcaatgattgatactggaaaagccttttgtgttgcaaataaacagttcatg
aatgggattcgagacctggctcagtattctagtaatgatgctgtcgttgagacaagtttg
accaagttttctgacagtcttcaagaaatgataaattttcacacaatcctgtttgaccaa
actcagagatcaattaaggcacagcttcagaactttgttaaagaagatcttagaaaattc
aaagatgccaagaagcaattcgaaaaagtcagtgaagaaaaagaaaatgcgttagtaaaa
aatgcccaagtacaaagaaacaaacaacatgaagttgaagaagccaccaacattctgaca
gcaacaagaaaatgtttccgacacatagccctcgattatgtgcttcagattaatgttctt
caatcaaaaaggagatcagaaatcctaaaatcaatgttgtcatttatgtatgcccatttg
gccttctttcatcaaggatatgatctgtttagtgaacttggaccctacatgaaggatctt
ggtgcacagttggatcgactggttgtggatgcagcaaaggagaaaagagaaatggagcaa
aaacattccaccattcaacaaaaggatttctccagtgatgattctaagttagaatataac
gtagatgctgcaaatggcatagttatggaaggatatctgttcaaacgagccagcaatgcc
ttcaaaacttggaacaggcgctggttttcaatacagaataatcagttggtttaccagaaa
aaatttaaggataatccgactgtggtagttgaagacctcaggctttgcacagtgaaacat
tgtgaagacatagagcgacgattctgctttgaggtggtctcgccaacaaaaagttgcatg
ctccaggcagattccgaaaagctgcgccaggcatggattaaggctgttcagaccagtatt
gctactgcttatagagagaagggtgatgaatcagagaagctggataagaaatcatctcca
tccacaggaagcctagattctggaaatgagtccaaagagaaattattgaaaggagaaagt
gcgcttcagcgggtccagtgtatccctggcaatgccagctgttgtgactgtggcctggca
gatccacggtgggccagcatcaacctgggcatcaccttgtgtatcgagtgctccggaatt
caccggagccttggggttcatttttcaaaagtacgatctttaactttagacacctgggag
ccagaacttttaaagcttatgtgtgagttggggaatgatgttataaatcgagtttatgaa
gctaatgtggaaaaaatgggaataaagaaaccccaaccaggacaaagacaggagaaggag
gcatatatcagagcaaaatatgtggagaggaaatttgtggataaatattctatatcatta
tcacctcctgagcagcaaaaaaagtttgtctctaaaagttctgaagaaaagaggctgagc
atttctaaatttgggccaggggaccaagtcagagcatctgcccaaagttcagtcagaagt
aatgacagtggaattcagcagagctctgatgatggaagagaatctttaccctccacggtg
tcagccaatagtttatatgagcctgaaggagaaaggcaagattcttctatgtttcttgac
tcgaaacatcttaatccaggacttcagctttatagggcgtcatatgaaaaaaaccttcct
aaaatggctgaggctttggctcatggtgcagacgtgaactgggccaattcagaggaaaac
aaagcgacaccacttattcaggctgtattagggggctctttggtgacgtgtgagttcctc
ctacagaatggtgctaatgtcaaccaaagagatgtccaagggcggggaccattgcaccat
gccaccgtcttagggcacacagggcaggtatgtttattcctaaaacgaggtgccaatcaa
catgccactgatgaagaagggaaagaccctttgagcatagctgtggaagcagccaatgct
gatatagtcaccttgttacgtttagcaagaatgaatgaagagatgcgggaatcagaagga
ctttatggacagccaggtgatgaaacttatcaggacatatttcgtgatttttcccaaatg
gcatccaataatccagagaaactaaatcgtttccagcaagattcacagaaattctga

DBGET integrated database retrieval system