KEGG   Homo sapiens (human): 23530Help
Entry
23530             CDS       T01001                                 

Gene name
NNT, GCCD4
Definition
nicotinamide nucleotide transhydrogenase (EC:1.6.1.2)
Orthology
K00323  
NAD(P) transhydrogenase [EC:1.6.1.2]
Organism
hsa  Homo sapiens (human)
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    23530 (NNT)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.1  With NAD+ or NADP+ as acceptor
    1.6.1.2  NAD(P)+ transhydrogenase (Re/Si-specific)
     23530 (NNT)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
5p12
AA seq 1086 aa AA seqDB search
MANLLKTVVTGCSCPLLSNLGSCKGLRVKKDFLRTFYTHQELWCKAPVKPGIPYKQLTVG
VPKEIFQNEKRVALSPAGVQNLVKQGFNVVVESGAGEASKFSDDHYRVAGAQIQGAKEVL
ASDLVVKVRAPMVNPTLGVHEADLLKTSGTLISFIYPAQNPELLNKLSQRKTTVLAMDQV
PRVTIAQGYDALSSMANIAGYKAVVLAANHFGRFFTGQITAAGKVPPAKILIVGGGVAGL
ASAGAAKSMGAIVRGFDTRAAALEQFKSLGAEPLEVDLKESGEGQGGYAKEMSKEFIEAE
MKLFAQQCKEVDILISTALIPGKKAPVLFNKEMIESMKEGSVVVDLAAEAGGNFETTKPG
ELYIHKGITHIGYTDLPSRMATQASTLYSNNITKLLKAISPDKDNFYFDVKDDFDFGTMG
HVIRGTVVMKDGKVIFPAPTPKNIPQGAPVKQKTVAELEAEKAATITPFRKTMSTASAYT
AGLTGILGLGIAAPNLAFSQMVTTFGLAGIVGYHTVWGVTPALHSPLMSVTNAISGLTAV
GGLALMGGHLYPSTTSQGLAALAAFISSVNIAGGFLVTQRMLDMFKRPTDPPEYNYLYLL
PAGTFVGGYLAALYSGYNIEQIMYLGSGLCCVGALAGLSTQGTARLGNALGMIGVAGGLA
ATLGVLKPGPELLAQMSGAMALGGTIGLTIAKRIQISDLPQLVAAFHSLVGLAAVLTCIA
EYIIEYPHFATDAAANLTKIVAYLGTYIGGVTFSGSLIAYGKLQGLLKSAPLLLPGRHLL
NAGLLAASVGGIIPFMVDPSFTTGITCLGSVSALSAVMGVTLTAAIGGADMPVVITVLNS
YSGWALCAEGFLLNNNLLTIVGALIGSSGAILSYIMCVAMNRSLANVILGGYGTTSTAGG
KPMEISGTHTEINLDNAIDMIREANSIIITPGYGLCAAKAQYPIADLVKMLTEQGKKVRF
GIHPVAGRMPGQLNVLLAEAGVPYDIVLEMDEINHDFPDTDLVLVIGANDTVNSAAQEDP
NSIIAGMPVLEVWKSKQVIVMKRSLGVGYAAVDNPIFYKPNTAMLLGDAKKTCDALQAKV
RESYQK
NT seq 3261 nt NT seq  +upstreamnt  +downstreamnt
atggcaaacctattgaaaacagtggtgactggctgctcgtgtcctctacttagcaatttg
gggtcctgtaagggtctacgtgtgaagaaggattttttacgaacattttatactcaccaa
gaactgtggtgtaaagcgcctgtaaaaccaggaattccatataagcaactgactgttgga
gtccccaaagagatattccaaaatgagaagcgagtggcattgtctcctgctggtgttcag
aacttggtcaagcagggttttaatgttgtcgtggaatcgggtgcgggcgaagcttccaag
ttctcagatgatcactatagagtggcaggtgcccaaatccaaggggcaaaggaagtgctg
gcttctgatttggtggtcaaagtgcgagcccctatggttaatccaacattaggtgttcat
gaagctgaccttttaaagacatcaggaacgctgattagttttatttacccagcccaaaat
ccagagttgctaaataaactttcccaaagaaaaactacagttctggcaatggaccaggtt
ccaagagtcacaattgctcagggatatgatgcgctaagctccatggccaacattgcgggt
tataaggctgttgtcctagcagcaaatcattttggacgtttttttactggtcagatcaca
gctgctggaaaagttcctccagctaagattctgatagttggtggtggtgttgctgggctt
gcttctgcaggcgcagcaaagtcgatgggtgcaattgttcgaggatttgacacaagagct
gcagctttggaacagttcaagtctcttggtgctgagcccttggaggtggacttgaaggaa
tctggtgagggacaaggaggatatgcaaaagagatgtccaaagagttcattgaagctgaa
atgaaactctttgctcaacaatgcaaggaggtagacatccttatcagcacagcacttatt
ccaggtaaaaaagctccagttttatttaataaagaaatgattgagtcaatgaaggaaggt
tcagttgttgtggatttagctgctgaggctggtggaaactttgaaaccactaagccagga
gaactctacattcataagggaattactcacataggctacacagacctgcccagccgaatg
gccactcaggccagcaccctatattccaacaacatcaccaaactcctgaaggccatcagc
ccggacaaagataatttttattttgatgtgaaagatgactttgactttggtacgatgggt
catgtcattagaggaactgtagtgatgaaagatggtaaagtgattttcccagctcccaca
ccgaaaaatattcctcaaggtgccccagtaaaacagaagacagtggctgagctggaagct
gaaaaagcagctaccattacacccttcaggaagacaatgtcaacggcttctgcatataca
gcaggtctcacagggatactgggtttgggcattgcggctcccaatctagccttttctcag
atggtgaccacttttggcttggctggcattgtggggtatcataccgtctggggagtgacc
cctgctctccactcaccactgatgtctgtgacaaatgcaatctcagggctgactgcagtt
ggtgggttggcactgatgggaggacatttgtatccttccacaacttctcagggccttgct
gctcttgctgcattcatatcctctgtcaacattgcaggtggctttctggtgactcagaga
atgctggacatgttcaagcgtcccactgaccccccagaatacaactacctgtacctgctc
cctgccggcacctttgttggtggatatttagctgccctctacagtggttataacattgaa
cagatcatgtacctaggctcgggtttgtgctgtgtcggtgccttggctggcctctccacc
cagggaacagcacgtcttggcaatgcactgggcatgattggggttgctggaggactggca
gccaccctcggagtcctaaaaccgggcccagaattactagctcagatgtctggagcgatg
gctttgggtggtaccattggattgacaattgccaaacgcatccagatttctgatttacct
caattagttgctgcttttcacagtttagtgggtttggcagctgtacttacttgcatagct
gagtacattatagaatatccacattttgctacggatgcagcagcaaatctcaccaagatt
gtggcctacctcggcacttacattggtggcgtcacctttagtgggtctctcattgcctat
ggaaaattgcagggtctcctgaaatctgcccctctcctactgcctggaaggcacttactc
aatgcaggcttactggctgctagtgtgggcgggataatcccattcatggtggacccaagc
tttactactggcatcacctgtctgggttcagtgtctgctctctctgctgtcatgggtgtg
actttgacagctgctattgggggtgctgacatgcccgtcgttatcactgtgctgaacagc
tactcaggctgggccctgtgtgcagagggcttcctgctcaacaacaatctgctgaccatc
gtgggtgcactcataggctcgtctggtgctatcctgtcatacatcatgtgtgtggcaatg
aatcgctccctggctaatgtgattcttggaggctatggcaccacttcaacagctggtgga
aaacccatggaaatttctggcacacatacggaaatcaaccttgacaatgcaattgacatg
attcgagaagctaatagcattattattacaccaggctatggtctctgtgcagccaaagct
caataccccattgctgatttggtaaagatgctcactgagcaaggcaaaaaagtcaggttt
ggaattcacccagttgcaggccgaatgcctggtcagcttaatgtgctgctggctgaggct
ggtgtgccatatgacattgtgttggaaatggatgagatcaaccatgattttccagatact
gatttggtccttgtaattggagctaatgacactgttaattcagcagctcaagaagatccc
aactctattattgcaggcatgccagtccttgaggtctggaaatcaaagcaggtgattgtt
atgaagaggtctttgggtgttggctatgctgcagtggacaatccaatcttctacaaacct
aacacggccatgcttctaggtgatgccaagaaaacatgtgacgcgctccaggcgaaagtt
agagaatcctatcagaagtaa

DBGET integrated database retrieval system