KEGG   Homo sapiens (human): 23533Help
Entry
23533             CDS       T01001                                 

Gene name
PIK3R5, F730038I15Rik, FOAP-2, P101-PI3K, p101
Definition
(RefSeq) phosphoinositide-3-kinase regulatory subunit 5
  KO
K21290  
phosphoinositide-3-kinase regulatory subunit 5/6
Organism
hsa  Homo sapiens (human)
Pathway
cGMP-PKG signaling pathway
Phospholipase D signaling pathway
PI3K-Akt signaling pathway
Adrenergic signaling in cardiomyocytes
Apelin signaling pathway
Platelet activation
Cholinergic synapse
Oxytocin signaling pathway
Toxoplasmosis
Kaposi's sarcoma-associated herpesvirus infection
Disease
H00848  
Ataxia with ocular apraxia (AOA)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04371 Apelin signaling pathway
    23533 (PIK3R5)
   04072 Phospholipase D signaling pathway
    23533 (PIK3R5)
   04022 cGMP - PKG signaling pathway
    23533 (PIK3R5)
   04151 PI3K-Akt signaling pathway
    23533 (PIK3R5)
 Organismal Systems
  Immune system
   04611 Platelet activation
    23533 (PIK3R5)
  Endocrine system
   04921 Oxytocin signaling pathway
    23533 (PIK3R5)
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    23533 (PIK3R5)
  Nervous system
   04725 Cholinergic synapse
    23533 (PIK3R5)
 Human Diseases
  Infectious diseases
   05167 Kaposi's sarcoma-associated herpesvirus infection
    23533 (PIK3R5)
   05145 Toxoplasmosis
    23533 (PIK3R5)
Membrane trafficking [BR:hsa04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    23533 (PIK3R5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
Q8WYR1(Tbio)
UniProt: 
Position
17p13.1
AA seq 880 aa AA seqDB search
MQPGATTCTEDRIQHALERCLHGLSLSRRSTSWSAGLCLNCWSLQELVSRDPGHFLILLE
QILQKTREVQEKGTYDLLTPLALLFYSTVLCTPHFPPDSDLLLKAASTYHRFLTWPVPYC
SICQELLTFIDAELKAPGISYQRLVRAEQGLPIRSHRSSTVTVLLLNPVEVQAEFLAVAN
KLSTPGHSPHSAYTTLLLHAFQATFGAHCDVPGLHCRLQAKTLAELEDIFTETAEAQELA
SGIGDAAEARRWLRTKLQAVGEKAGFPGVLDTAKPGKLHTIPIPVARCYTYSWSQDSFDI
LQEILLKEQELLQPGILGDDEEEEEEEEEVEEDLETDGHCAERDSLLSTSSLASHDSTLS
LASSQASGPALSRHLLTSFVSGLSDGMDSGYVEDSEESSSEWPWRRGSQERRGHRRPGQK
FIRIYKLFKSTSQLVLRRDSRSLEGSSDTALPLRRAGSLCSPLDEPVSPPSRAQRSRSLP
QPKLGTQLPSWLLAPASRPQRRRPFLSGDEDPKASTLRVVVFGSDRISGKVARAYSNLRR
LENNRPLLTRFFKLQFFYVPVKRSHGTSPGACPPPRSQTPSPPTDSPRHASPGELGTTPW
EESTNDISHYLGMLDPWYERNVLGLMHLPPEVLCQQSLKAEAQALEGSPTQLPILADMLL
YYCRFAARPVLLQVYQTELTFITGEKTTEIFIHSLELGHSAATRAIKASGPGSKRLGIDG
DREAVPLTLQIIYSKGAISGRSRWSNLEKVCTSVNLNKACRKQEELDSSMEALTLNLTEV
VKRQNSKSKKGFNQISTSQIKVDKVQIIGSNSCPFAVCLDQDERKILQSVVRCEVSPCYK
PEKSDLSSPPQTPPDLPAQAAPDLCSLLCLPIMTFSGALP
NT seq 2643 nt NT seq  +upstreamnt  +downstreamnt
atgcagccaggggccacgacatgcacggaggaccgcatccagcatgccctggaacgctgc
ctgcatggactcagcctcagccgccgctccacctcctggtcagctgggctgtgtctgaac
tgctggagcctgcaggagctggtcagcagggacccgggccacttccttatcctccttgag
cagatcctgcagaagacccgagaggtccaggagaagggcacctacgacctgctcaccccg
ctggccctgctcttctattccactgttctttgtacaccacacttcccaccagactcggat
ctccttctgaaggcagccagcacctaccaccggttcctgacctggcctgttccttactgc
agcatctgccaggagctgctcaccttcattgatgctgaactcaaggccccagggatctcc
taccagagactggtgagggctgagcagggcctgcccatcaggagtcaccgcagctccacc
gtcaccgtgctgctgctgaacccagtggaagtgcaggccgagttccttgctgtagccaat
aagctgagtacgcccggacactcgcctcacagtgcctacaccaccctgctcctgcacgcc
ttccaggccacctttggggcccactgtgacgtcccgggcctgcactgcaggctacaggcc
aagaccctggcagagcttgaggacatcttcacggagaccgcagaggcacaggagctggca
tctggcatcggggatgctgcagaggcccggcggtggctcaggaccaagctgcaggcggtg
ggagaaaaagctggcttccctggggtgttagacactgcaaaaccagggaagctccacacc
atccccatccctgtcgccaggtgctacacctacagctggagccaggacagctttgacatc
ctgcaggaaatcctgctcaaggaacaggagctactccagccagggatcctgggagatgat
gaagaggaggaagaggaggaggaggaggtggaggaggacttggaaactgacgggcactgt
gccgagagagattccctgctctccaccagctctttggcgtcccatgactccaccttgtcc
cttgcatcctcccaggcctcggggccggccctctcgcgccatctgctgacttcctttgtc
tcaggcctctctgatggcatggacagcggctacgtggaggacagcgaggagagctcctcc
gagtggccttggaggcgtggcagccaggaacgccgaggccaccgcaggcctgggcagaag
ttcatcaggatctataaactcttcaagagcaccagccagctggtactgcggagggactct
cggagcctggagggcagctcggacacggccctgcccctgaggcgggcagggagcctctgc
agccccctggacgaaccagtatcacccccttcccgggcccagcgctcccgctccctgccc
cagcccaaactcggtacccagctgcccagctggcttctggcccctgcttcacgcccccag
cgccgccgccccttcctgagtggagatgaggatcccaaggcttccacgctacgtgttgtg
gtctttggctccgatcggatttcagggaaggtggctcgggcgtacagcaaccttcggcgg
ctggagaacaatcgcccactcctcacacggttcttcaaacttcagttcttctacgtgcct
gtgaagcgaagtcatgggaccagccctggtgcctgtccaccccctcggagccagacgccc
tcacccccgacagactcccctaggcacgccagccctggagagctgggcaccaccccatgg
gaggagagcaccaatgacatctcccactacctcggcatgctggacccctggtatgagcgc
aatgtactgggcctcatgcacctgccccctgaagtcctgtgccagcagtccctgaaggct
gaagcccaggccctggagggctccccaacccagctgcccatcctggctgacatgctactc
tactactgccgctttgccgccagaccggtgctgctgcaagtctatcagaccgagctgacc
ttcatcactggggagaagacgacagagatcttcatccactccttggagctgggtcactcc
gctgccacacgtgccatcaaggcgtcaggtcctggcagcaagcggctgggcatcgatggc
gaccgggaggctgttcctctaacactacagattatttacagcaagggggccatcagtgga
cgaagtcgctggagcaacctggagaaggtctgtacctccgtgaacctcaacaaggcctgc
cggaagcaggaggagctggattccagcatggaggccctgacgctaaacctgacagaagtg
gtgaaaaggcagaactccaaatccaagaagggctttaaccagattagcacatcgcagatc
aaagtggacaaggtgcagatcatcggctccaacagctgcccctttgctgtgtgcctggac
caggatgagagaaagatcctgcagagtgtagtcagatgtgaggtctcaccgtgctacaag
ccagagaagagcgacctctcctcaccaccccagacgcctcctgacctgccggcccaggcc
gcacctgatctctgctcccttctctgcctgcccatcatgactttcagtggagctctgccc
tag

DBGET integrated database retrieval system