KEGG   Homo sapiens (human): 23538Help
Entry
23538             CDS       T01001                                 

Gene name
OR52A1, HPFH1OR
Definition
(RefSeq) olfactory receptor family 52 subfamily A member 1
  KO
K04257  olfactory receptor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Sensory system
   04740 Olfactory transduction
    23538 (OR52A1)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Chemoreception
   Olfactory
    23538 (OR52A1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_4 7tm_1 7TM_GPCR_Srsx
Motif
Other DBs
NCBI-GeneID: 23538
NCBI-ProteinID: NP_036507
HGNC: 8318
Ensembl: ENSG00000182070
Vega: OTTHUMG00000066603
Pharos: Q9UKL2(Tdark)
UniProt: Q9UKL2
Position
11p15.4
AA seq 312 aa AA seqDB search
MSISNITVYMPSVLTLVGIPGLESVQCWIGIPFCAIYLIAMIGNSLLLSIIKSERSLHEP
LYIFLGMLGATDIALASSIMPKMLGIFWFNVPEIYFDSCLLQMWFIHTLQGIESGILVAM
ALDRYVAICYPLRHANIFTHQLVIQIGTMVVLRAAILVAPCLVLIKCRFQFYHTTVISHS
YCEHMAIVKLAAANVQVNKIYGLFVAFTVAGFDLTFITLSYIQIFITVFRLPQKEARFKA
FNTCIAHICVFLQFYLLAFFSFFTHRFGSHISPYIHILFSSIYLLVPPFLNPLVYGAKTT
QIRIHVVKMFCS
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atgtccatttccaacatcacagtctacatgccctctgtgttgacactagtagggatccca
ggcctagaatctgtgcagtgctggattgggattccattctgtgccatttatctcattgct
atgattggaaattccttgcttctgagcatcatcaaatctgagcgcagtctccatgagccc
ttgtacattttcttaggcatgctaggagccacagacattgcacttgctagcagcattatg
ccaaagatgcttggaatattctggtttaatgtgcctgaaatctattttgattcctgcttg
cttcaaatgtggttcatccacacattgcagggtatagagtcaggcatccttgtggccatg
gccctggaccgttatgtggccatctgttatccactaagacatgccaacatcttcacccac
cagcttgtcattcagataggaactatggtcgtactcagggctgctattcttgtagcccca
tgcctagtactgataaagtgccggtttcaattttatcacacaacagtcatctcccactcc
tactgtgagcatatggccattgtgaaactagcagcagcaaatgttcaagtcaacaaaatc
tatggtttgtttgtggccttcactgtagcaggatttgacctcacattcatcacattgtcc
tacatccagatatttatcacagtttttcgtttgccccagaaggaggctaggtttaaagca
ttcaatacctgcattgctcacatctgtgtcttcctccagttctacctccttgccttcttc
tccttcttcacacataggtttgggtctcacatctccccttatatccatattctcttttct
agcatttacttgctggtccctccatttctcaatccacttgtctatggtgcaaagaccaca
cagattcgcattcatgtggtaaaaatgttctgttcataa

DBGET integrated database retrieval system