KEGG   Homo sapiens (human): 23539Help
Entry
23539             CDS       T01001                                 

Gene name
SLC16A8, MCT3, REMP
Definition
(RefSeq) solute carrier family 16 member 8
  KO
K08185  
MFS transporter, MCP family, solute carrier family 16 (monocarboxylic acid transporters), member 8
Organism
hsa  Homo sapiens (human)
Brite
Transporters [BR:hsa02000]
 Solute Carrier Family (SLC)
  SLC16: Monocarboxylate transporter
   23539 (SLC16A8)
 Major Facilitator Superfamily (MFS)
  Organic acid transporters
   Monocarboxylate porter (MCP) family [TC:2.A.1.13]
    23539 (SLC16A8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
22q13.1
AA seq 504 aa AA seqDB search
MGAGGPRRGEGPPDGGWGWVVLGACFVVTGFAYGFPKAVSVFFRALMRDFDAGYSDTAWV
SSIMLAMLYGTGPVSSILVTRFGCRPVMLAGGLLASAGMILASFATRLLELYLTAGVLTG
LGLALNFQPSLIMLGLYFERRRPLANGLAAAGSPVFLSALSPLGQQLLERFGWRGGFLLL
GGLLLHCCACGAVMRPPPGPGPRPRRDSAGDRAGDAPGEAEADGAGLQLREASPRVRPRR
RLLDLAVCTDRAFAVYAVTKFLMALGLFVPAILLVNYAKDAGVPDTDAAFLLSIVGFVDI
VARPACGALAGLARLRPHVPYLFSLALLANGLTDLSSARARSYGALVAFCVAFGLSYGMV
GALQFEVLMAAVGAPRFPSALGLVLLVEAAAVLIGPPSAGRLVDVLKNYEIIFYLAGSEV
ALAGVFMAVATNCCLRCAKAAPSGPGTEGGASDTEDAEAEGDSEPLPVVAEEPGNLEALE
VLSARGEPTEPEIEARPRLAAESV
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
atgggcgctggcggcccccggcggggcgagggccccccagacggcggctggggctgggtg
gtgctgggcgcctgctttgtggtcaccggcttcgcctacggcttccccaaagccgtgagc
gtcttcttccgcgcgctcatgcgcgacttcgacgccggctacagcgacacggcctgggtg
tcctccatcatgctagccatgctctacggcacgggccccgtgtccagcatcctcgtgacc
cgctttggctgtcgcccggtgatgctggcgggtgggctgctggcttccgcgggcatgatc
ctagcttcctttgccacgcgcctcctggagctctacctgaccgctggggtgctcacaggc
ctgggcctggccctcaacttccagccgtcgctcatcatgctggggctgtacttcgagcgg
cggcggcctctggccaacgggctggcggcggcgggcagccccgtgttcctgtccgcgctg
tcgccgctcggccagcagctgctggagcgcttcggctggcgcggcggcttcctgctgctc
ggcgggctcctgctgcactgctgcgcctgcggggctgtcatgaggccgccgcccgggccg
ggcccgcgaccgcgcagggacagcgccggcgaccgcgccggggacgctccgggcgaggcg
gaggctgacggtgcggggctgcagctgcgcgaggcatcccccagggtccggccccgccgg
cgcctgctggacttggcagtgtgcaccgaccgcgccttcgccgtgtacgccgtcaccaag
ttcctgatggcgctcgggctcttcgtccccgccatcctgctggtgaactacgccaaggac
gcgggcgtgcccgacaccgacgccgccttcctgctgtccatcgtgggcttcgtggacatc
gtggcgcgcccggcgtgcggcgccctggcgggcctggcgcgtctgcggccgcacgtcccg
tatctgttcagcctggccctgctggccaatgggctcacagacctgagcagcgcacgcgcg
cgctcctacggcgccctcgtcgccttctgcgtcgccttcggcctctcctacggcatggtg
ggcgcgctgcagttcgaggtgctcatggcggctgtgggcgcgccccgcttccccagtgcg
ctgggcctggtgttgctcgtggaggccgcggctgtgctcatcggaccgccctctgccggc
cgcctggtggatgtgttgaagaactatgagatcatcttctacctggccggctctgaggtg
gccctggctggggtcttcatggctgtcgccaccaactgctgcctgcgttgtgctaaagct
gccccgtcaggcccaggcactgagggcggagccagtgacactgaggacgctgaggctgaa
ggggactctgagcccctgcctgttgttgcagaggaacccggcaacctggaggccctggag
gtgctcagcgcccggggcgagcccacagaaccagaaatagaggcgaggccgaggctggct
gccgagtctgtataa

DBGET integrated database retrieval system