KEGG   Homo sapiens (human): 2354Help
Entry
2354              CDS       T01001                                 

Gene name
FOSB, AP-1, G0S3, GOS3, GOSB
Definition
FBJ murine osteosarcoma viral oncogene homolog B
Orthology
K09029  
protein FosB
Organism
hsa  Homo sapiens (human)
Pathway
Osteoclast differentiation
Cocaine addiction
Amphetamine addiction
Alcoholism
Class
Organismal Systems; Development; Osteoclast differentiation [PATH:hsa04380]
Human Diseases; Substance dependence; Cocaine addiction [PATH:hsa05030]
Human Diseases; Substance dependence; Amphetamine addiction [PATH:hsa05031]
Human Diseases; Substance dependence; Alcoholism [PATH:hsa05034]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
19q13.32
AA seq 302 aa AA seqDB search
MFQAFPGDYDSGSRCSSSPSAESQYLSSVDSFGSPPTAAASQECAGLGEMPGSFVPTVTA
ITTSQDLQWLVQPTLISSMAQSQGQPLASQPPVVDPYDMPGTSYSTPGMSGYSSGGASGS
GGPSTSGTTSGPGPARPARARPRRPREETETDQLEEEKAELESEIAELQKEKERLEFVLV
AHKPGCKIPYEEGPGPGPLAEVRDLPGSAPAKEDGFSWLLPPPPPPPLPFQTSQDAPPNL
TASLFTHSEVQVLGDPFPVVNPSYTSSFVLTCPEVSAFAGAQRTSGSDQPSDPLNSPSLL
AL
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atgtttcaggctttccccggagactacgactccggctcccggtgcagctcctcaccctct
gccgagtctcaatatctgtcttcggtggactccttcggcagtccacccaccgccgccgcc
tcccaggagtgcgccggtctcggggaaatgcccggttccttcgtgcccacggtcaccgcg
atcacaaccagccaggacctccagtggcttgtgcaacccaccctcatctcttccatggcc
cagtcccaggggcagccactggcctcccagcccccggtcgtcgacccctacgacatgccg
ggaaccagctactccacaccaggcatgagtggctacagcagtggcggagcgagtggcagt
ggtgggccttccaccagcggaactaccagtgggcctgggcctgcccgcccagcccgagcc
cggcctaggagaccccgagaggagacggagacagatcagttggaggaagaaaaagcagag
ctggagtcggagatcgccgagctccaaaaggagaaggaacgtctggagtttgtgctggtg
gcccacaaaccgggctgcaagatcccctacgaagaggggcccgggccgggcccgctggcg
gaggtgagagatttgccgggctcagcaccggctaaggaagatggcttcagctggctgctg
ccgcccccgccaccaccgcccctgcccttccagaccagccaagacgcaccccccaacctg
acggcttctctctttacacacagtgaagttcaagtcctcggcgaccccttccccgttgtt
aacccttcgtacacttcttcgtttgtcctcacctgcccggaggtctccgcgttcgccggc
gcccaacgcaccagcggcagtgaccagccttccgatcccctgaactcgccctccctcctc
gctctgtga

DBGET integrated database retrieval system