KEGG   Homo sapiens (human): 2354Help
Entry
2354              CDS       T01001                                 

Gene name
FOSB, AP-1, G0S3, GOS3, GOSB
Definition
(RefSeq) FosB proto-oncogene, AP-1 trancription factor subunit
  KO
K09029  
protein FosB
Organism
hsa  Homo sapiens (human)
Pathway
Osteoclast differentiation
Cocaine addiction
Amphetamine addiction
Alcoholism
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Development
   04380 Osteoclast differentiation
    2354 (FOSB)
 Human Diseases
  Substance dependence
   05030 Cocaine addiction
    2354 (FOSB)
   05031 Amphetamine addiction
    2354 (FOSB)
   05034 Alcoholism
    2354 (FOSB)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  Basic leucine zipper (bZIP)
   AP-1(-like) components, Fos
    2354 (FOSB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
19q13.32
AA seq 338 aa AA seqDB search
MFQAFPGDYDSGSRCSSSPSAESQYLSSVDSFGSPPTAAASQECAGLGEMPGSFVPTVTA
ITTSQDLQWLVQPTLISSMAQSQGQPLASQPPVVDPYDMPGTSYSTPGMSGYSSGGASGS
GGPSTSGTTSGPGPARPARARPRRPREETLTPEEEEKRRVRRERNKLAAAKCRNRRRELT
DRLQAETDQLEEEKAELESEIAELQKEKERLEFVLVAHKPGCKIPYEEGPGPGPLAEVRD
LPGSAPAKEDGFSWLLPPPPPPPLPFQTSQDAPPNLTASLFTHSEVQVLGDPFPVVNPSY
TSSFVLTCPEVSAFAGAQRTSGSDQPSDPLNSPSLLAL
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atgtttcaggctttccccggagactacgactccggctcccggtgcagctcctcaccctct
gccgagtctcaatatctgtcttcggtggactccttcggcagtccacccaccgccgccgcc
tcccaggagtgcgccggtctcggggaaatgcccggttccttcgtgcccacggtcaccgcg
atcacaaccagccaggacctccagtggcttgtgcaacccaccctcatctcttccatggcc
cagtcccaggggcagccactggcctcccagcccccggtcgtcgacccctacgacatgccg
ggaaccagctactccacaccaggcatgagtggctacagcagtggcggagcgagtggcagt
ggtgggccttccaccagcggaactaccagtgggcctgggcctgcccgcccagcccgagcc
cggcctaggagaccccgagaggagacgctcaccccagaggaagaggagaagcgaagggtg
cgccgggaacgaaataaactagcagcagctaaatgcaggaaccggcggagggagctgacc
gaccgactccaggcggagacagatcagttggaggaagaaaaagcagagctggagtcggag
atcgccgagctccaaaaggagaaggaacgtctggagtttgtgctggtggcccacaaaccg
ggctgcaagatcccctacgaagaggggcccgggccgggcccgctggcggaggtgagagat
ttgccgggctcagcaccggctaaggaagatggcttcagctggctgctgccgcccccgcca
ccaccgcccctgcccttccagaccagccaagacgcaccccccaacctgacggcttctctc
tttacacacagtgaagttcaagtcctcggcgaccccttccccgttgttaacccttcgtac
acttcttcgtttgtcctcacctgcccggaggtctccgcgttcgccggcgcccaacgcacc
agcggcagtgaccagccttccgatcccctgaactcgccctccctcctcgctctgtga

DBGET integrated database retrieval system