KEGG   Homo sapiens (human): 23542Help
Entry
23542             CDS       T01001                                 

Gene name
MAPK8IP2, IB-2, IB2, JIP2, PRKM8IPL
Definition
mitogen-activated protein kinase 8 interacting protein 2
Orthology
K04435  
mitogen-activated protein kinase 8 interacting protein 2
Organism
hsa  Homo sapiens (human)
Pathway
MAPK signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    23542 (MAPK8IP2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
UniProt: 
Position
22q13.33
AA seq 824 aa AA seqDB search
MADRAEMFSLSTFHSLSPPGCRPPQDISLEEFDDEDLSEITDDCGLGLSYDSDHCEKDSL
SLGRSEQPHPICSFQDDFQEFEMIDDNEEEDDEDEEEEEEEEEGDGEGQEGGDPGSEAPA
PGPLIPSPSVEEPHKHRPTTLRLTTLGAQDSLNNNGGFDLVRPASWQETALCSPAPEALR
ELPGPLPATDTGPGGAQSPVRPGCDCEGNRPAEPPAPGGTSPSSDPGIEADLRSRSSGGR
GGRRSSQELSSPGSDSEDAGGARLGRMISSISETELELSSDGGSSSSGRSSHLTNSIEEA
SSPASEPEPPREPPRRPAFLPVGPDDTNSEYESGSESEPDLSEDADSPWLLSNLVSRMIS
EGSSPIRCPGQCLSPAPRPPGEPVSPAGGAAQDSQDPEAAAGPGGVELVDMETLCAPPPP
APAAPRPGPAQPGPCLFLSNPTRDTITPLWAAPGRAARPGRACSAACSEEEDEEDDEEEE
DAEDSAGSPGGRGTGPSAPRDASLVYDAVKYTLVVDEHTQLELVSLRRCAGLGHDSEEDS
GGEASEEEAGAALLGGGQVSGDTSPDSPDLTFSKKFLNVFVNSTSRSSSTESFGLFSCLV
NGEEREQTHRAVFRFIPRHPDELELDVDDPVLVEAEEDDFWFRGFNMRTGERGVFPAFYA
HAVPGPAKDLLGSKRSPCWVERFDVQFLGSVEVPCHQGNGILCAAMQKIATARKLTVHLR
PPASCDLEISLRGVKLSLSGGGPEFQRCSHFFQMKNISFCGCHPRNSCYFGFITKHPLLS
RFACHVFVSQESMRPVAQSVGRAFLEYYQEHLAYACPTEDIYLE
NT seq 2475 nt NT seq  +upstreamnt  +downstreamnt
atggcggatcgcgcggagatgttttctctctccaccttccactcgctgtcgccgccgggc
tgcaggcctccccaggacataagcctggaagaatttgacgacgaagatctgtctgagatc
actgatgactgtggcctgggcctcagctacgactcagaccactgtgagaaggacagcctc
tccctggggcgctcggagcagccgcaccccatctgctccttccaggatgacttccaggag
tttgagatgatcgatgacaatgaagaggaggacgatgaggacgaggaagaggaggaggag
gaggaggagggagatggggaaggccaggagggaggagaccctggctcagaggcacctgcc
cccgggccccttatcccctccccttccgtggaggagccccacaagcaccggcccaccacc
ctccgtctgaccacactgggggcccaggactccctaaacaacaacggaggctttgacctg
gtgcgtccggcctcctggcaggagacagcgctatgctcacccgccccggaggccctcaga
gagctcccgggccccctccctgccacggacaccgggcccggcggggcgcagtcgccagtg
cgcccgggttgcgactgcgaagggaaccggcctgcggaaccccctgcgccaggggggact
tcgccctcctcagatcccggcatcgaggctgacctgagaagccgctcgagcggcggccgc
gggggacgtcgcagcagccaggagctgtcctcgcccggctccgactcggaggacgcgggc
ggcgcgcgcctggggcgcatgatctcgtccatctcggagacggagctggagctgagcagc
gatggcggaagcagcagcagcggccgctcctcgcacctcaccaactccatcgaggaggcc
tcgtcgcccgcctcggagccggagcccccgcgcgaacccccgcgccgccccgccttcctg
cccgtgggccccgacgacaccaacagcgagtacgagtcggggtcggagtcggagccggac
ctcagcgaggacgcggactcgccctggctgctcagcaacctggtgagccgcatgatctcc
gagggctcctcgcccatccgctgccccggccagtgcctgtctcctgcgccgcgcccgccc
ggggagcccgtgtcgccggccggcggggccgcccaggactcccaggaccccgaggcggcc
gcggggcccggcggcgtggagctggtggacatggagacgctgtgcgcgccgccgccgccc
gcgcccgccgcgcctcgacccggccccgcgcagcccgggccctgcctattcctcagcaac
cccacgcgtgacaccatcacgccgctgtgggccgcgcccggccgcgccgcccgcccggga
cgagcctgctccgccgcctgctccgaggaggaggacgaagaggacgacgaggaagaggag
gatgccgaggacagtgcggggtcccccgggggcaggggcacgggcccctcggcgccgcgg
gacgcgtcgctggtgtacgacgcggtcaagtacacgctggtggtggatgagcacacgcag
ctggagctggtgagcctgcggcgctgtgctgggctgggccacgacagcgaagaggacagc
ggcggggaggccagcgaggaggaggcgggcgcggcgctgctaggcggcggtcaggtctcg
ggggacacctcgccggacagccctgacctcactttctccaagaagttcctcaatgtcttc
gtcaacagcacatctcggtcctccagcaccgagtcctttggccttttctcctgtctggtc
aacggcgaggagcgagagcagactcaccgggctgtgttcaggttcatcccgcggcatcca
gacgagctggagctggatgtggatgaccctgtgttggtggaggccgaggaggacgacttc
tggttccgtggcttcaacatgcgcacgggggagcgcggtgtgtttcctgccttctacgcc
catgcggtgcccggccctgccaaggacctgctggggagtaagcggagcccctgctgggtg
gagcgctttgacgtgcagttcctgggctccgtggaggtgccctgccaccagggcaacggc
atcctgtgtgcagccatgcagaagattgccactgcccggaaactgaccgtccacctgcgc
cctcctgcctcctgtgacctcgagatctctcttcggggggtcaagctgagtctgagcgga
ggagggcccgagttccagcgctgcagccatttcttccagatgaagaacatctccttctgc
ggctgccatccccgcaacagctgctatttcggcttcatcaccaaacaccccctgctgagc
cgcttcgcctgccacgtctttgtctcccaggagtccatgaggccggtggcgcagagtgtg
ggccgcgccttcctggagtactaccaagagcacctggcgtacgcctgccccacggaggac
atctacctggagtag

DBGET integrated database retrieval system